Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H0Q9

Protein Details
Accession A0A2I1H0Q9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-53VHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDBasic
NLS Segment(s)
PositionSequence
6-44KKAVLKGVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRK
Subcellular Location(s) mito 19.5, cyto_mito 11.333, nucl 5.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001014  Ribosomal_L23/L25_CS  
IPR005633  Ribosomal_L23/L25_N  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
PF03939  Ribosomal_L23eN  
PROSITE View protein in PROSITE  
PS00050  RIBOSOMAL_L23  
Amino Acid Sequences KALSAKKAVLKGVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.6
4 0.69
5 0.72
6 0.72
7 0.73
8 0.73
9 0.76
10 0.78
11 0.79
12 0.79
13 0.81
14 0.74
15 0.74
16 0.67
17 0.65
18 0.68
19 0.68
20 0.67
21 0.66
22 0.75
23 0.72
24 0.8
25 0.84
26 0.84
27 0.82
28 0.82
29 0.81
30 0.78
31 0.8
32 0.8
33 0.8
34 0.8
35 0.74
36 0.66
37 0.64
38 0.61
39 0.54
40 0.47
41 0.43
42 0.42
43 0.43
44 0.45
45 0.4
46 0.36
47 0.4
48 0.37
49 0.33
50 0.24
51 0.24
52 0.2
53 0.2
54 0.21
55 0.16
56 0.15
57 0.15
58 0.16
59 0.15
60 0.17
61 0.15
62 0.15
63 0.15
64 0.14
65 0.12
66 0.11
67 0.1
68 0.1
69 0.1
70 0.11
71 0.17
72 0.24
73 0.25
74 0.26
75 0.28
76 0.32
77 0.41
78 0.48
79 0.51
80 0.53
81 0.53
82 0.53
83 0.51
84 0.49
85 0.45
86 0.38
87 0.33
88 0.3
89 0.29
90 0.29
91 0.29
92 0.26
93 0.24
94 0.25
95 0.23
96 0.22
97 0.29
98 0.32
99 0.39
100 0.4
101 0.43
102 0.41
103 0.49
104 0.51
105 0.48
106 0.48
107 0.45
108 0.48
109 0.44
110 0.43
111 0.33