Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GSK9

Protein Details
Accession A0A2I1GSK9   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-127RENEKGKGERKGRRERKGRGERKGRGNTLBasic
NLS Segment(s)
PositionSequence
91-124GKGRTKGKRENEKGKGERKGRRERKGRGERKGRG
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MTQHRLKIWILILYDAKRRIIPSGNKVIDDFIRYTQTNYVKDNGKMIFVPYEKFENIEFIGEGGFSKIYKATWIDCKISDNGTLGTDKTFGKGRTKGKRENEKGKGERKGRRERKGRGERKGRGNTLVNRSKTIALKKLNNSKNVTSKELNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.3
5 0.3
6 0.31
7 0.35
8 0.39
9 0.41
10 0.49
11 0.49
12 0.48
13 0.48
14 0.46
15 0.38
16 0.34
17 0.27
18 0.19
19 0.22
20 0.21
21 0.22
22 0.26
23 0.31
24 0.31
25 0.31
26 0.33
27 0.33
28 0.33
29 0.36
30 0.3
31 0.26
32 0.23
33 0.22
34 0.22
35 0.19
36 0.19
37 0.16
38 0.19
39 0.17
40 0.18
41 0.17
42 0.14
43 0.14
44 0.13
45 0.11
46 0.08
47 0.08
48 0.07
49 0.07
50 0.05
51 0.05
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.07
58 0.09
59 0.16
60 0.19
61 0.2
62 0.2
63 0.22
64 0.21
65 0.21
66 0.2
67 0.14
68 0.12
69 0.11
70 0.11
71 0.1
72 0.09
73 0.1
74 0.09
75 0.09
76 0.13
77 0.14
78 0.19
79 0.26
80 0.34
81 0.43
82 0.5
83 0.57
84 0.63
85 0.73
86 0.76
87 0.79
88 0.79
89 0.79
90 0.79
91 0.78
92 0.77
93 0.75
94 0.73
95 0.73
96 0.76
97 0.76
98 0.79
99 0.81
100 0.81
101 0.84
102 0.88
103 0.87
104 0.86
105 0.87
106 0.85
107 0.86
108 0.86
109 0.78
110 0.73
111 0.72
112 0.69
113 0.69
114 0.69
115 0.61
116 0.54
117 0.53
118 0.52
119 0.5
120 0.49
121 0.47
122 0.46
123 0.53
124 0.59
125 0.67
126 0.69
127 0.7
128 0.69
129 0.69
130 0.7
131 0.67
132 0.64