Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P5A6

Protein Details
Accession J3P5A6    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-53QDFLPRRRFDPRRSKLHHDVPLEBasic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 11, nucl 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
Pfam View protein in Pfam  
PF00075  RNase_H  
Amino Acid Sequences MDLVTAKSRAIGAWDERSAPRNSLIPDDDEQDFLPRRRFDPRRSKLHHDVPLEELVQYDEQRQVARLAMRHPRTGAIEVDESTVVVAIDAACRDTGRSSARAAWAVCFGPASCRRNECGVLPLRAISSLLKSARPVPQTVPRAEIEALARALQAVANLTRGDFAVREVIVRSHSEFLVRAMSEWIEEWIENKGRRECGTRVPNFDALSDVSELVDDVEYGVGGGGGGDGNGESDEGSGGLEILFWHTHRDGTFSADWLVEYGFDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.32
4 0.37
5 0.36
6 0.33
7 0.3
8 0.29
9 0.29
10 0.32
11 0.32
12 0.31
13 0.31
14 0.32
15 0.3
16 0.27
17 0.26
18 0.25
19 0.28
20 0.27
21 0.32
22 0.31
23 0.32
24 0.42
25 0.49
26 0.54
27 0.6
28 0.66
29 0.7
30 0.75
31 0.82
32 0.81
33 0.83
34 0.81
35 0.73
36 0.66
37 0.59
38 0.54
39 0.45
40 0.35
41 0.26
42 0.2
43 0.18
44 0.16
45 0.14
46 0.14
47 0.14
48 0.15
49 0.15
50 0.15
51 0.16
52 0.19
53 0.19
54 0.23
55 0.31
56 0.34
57 0.35
58 0.35
59 0.34
60 0.34
61 0.34
62 0.29
63 0.23
64 0.21
65 0.19
66 0.2
67 0.17
68 0.14
69 0.11
70 0.1
71 0.06
72 0.05
73 0.04
74 0.03
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.09
83 0.11
84 0.13
85 0.14
86 0.17
87 0.18
88 0.21
89 0.2
90 0.18
91 0.17
92 0.16
93 0.14
94 0.12
95 0.1
96 0.14
97 0.2
98 0.22
99 0.22
100 0.24
101 0.26
102 0.29
103 0.3
104 0.24
105 0.24
106 0.25
107 0.25
108 0.23
109 0.22
110 0.19
111 0.18
112 0.17
113 0.11
114 0.08
115 0.1
116 0.11
117 0.11
118 0.12
119 0.15
120 0.19
121 0.2
122 0.2
123 0.2
124 0.27
125 0.31
126 0.31
127 0.31
128 0.26
129 0.27
130 0.26
131 0.24
132 0.17
133 0.14
134 0.14
135 0.1
136 0.1
137 0.08
138 0.08
139 0.06
140 0.06
141 0.05
142 0.05
143 0.06
144 0.06
145 0.06
146 0.07
147 0.06
148 0.07
149 0.06
150 0.06
151 0.08
152 0.08
153 0.08
154 0.08
155 0.09
156 0.1
157 0.12
158 0.13
159 0.12
160 0.12
161 0.13
162 0.12
163 0.12
164 0.14
165 0.13
166 0.12
167 0.11
168 0.11
169 0.1
170 0.1
171 0.1
172 0.08
173 0.08
174 0.08
175 0.11
176 0.17
177 0.19
178 0.23
179 0.26
180 0.28
181 0.31
182 0.35
183 0.34
184 0.39
185 0.46
186 0.46
187 0.49
188 0.5
189 0.52
190 0.47
191 0.44
192 0.36
193 0.27
194 0.24
195 0.19
196 0.14
197 0.1
198 0.1
199 0.09
200 0.08
201 0.07
202 0.05
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.04
220 0.04
221 0.05
222 0.05
223 0.05
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.07
230 0.08
231 0.09
232 0.13
233 0.14
234 0.17
235 0.17
236 0.21
237 0.19
238 0.24
239 0.25
240 0.23
241 0.23
242 0.21
243 0.21
244 0.17
245 0.17
246 0.11