Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HSI2

Protein Details
Accession A0A2I1HSI2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-102EDGSRKRGKKRVTNNPNPGRGNBasic
NLS Segment(s)
PositionSequence
85-114RKRGKKRVTNNPNPGRGNEFKRISKRVKVK
Subcellular Location(s) nucl 19, cyto_nucl 12.333, cyto 3.5, cyto_pero 2.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
CDD cd11660  SANT_TRF  
Amino Acid Sequences MDPKVTELSSKDQNDSSVNSVGKTEEPNNDKSLTDDLSRKTTRQETKESRSSSSSISQLPEQQTVDYMQTSSEESSTEQPEDGSRKRGKKRVTNNPNPGRGNEFKRISKRVKVKWNERELHALEEGIRQYGKSWTNIKKKYGSEGQVLERRTQTQLKDKARSEFVRRLRDGVELGDFEIMDSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.33
4 0.29
5 0.27
6 0.25
7 0.24
8 0.23
9 0.23
10 0.24
11 0.24
12 0.26
13 0.3
14 0.33
15 0.35
16 0.35
17 0.33
18 0.31
19 0.3
20 0.24
21 0.24
22 0.25
23 0.25
24 0.32
25 0.33
26 0.32
27 0.34
28 0.41
29 0.46
30 0.46
31 0.54
32 0.55
33 0.61
34 0.69
35 0.65
36 0.59
37 0.54
38 0.5
39 0.43
40 0.38
41 0.32
42 0.26
43 0.25
44 0.23
45 0.25
46 0.26
47 0.26
48 0.23
49 0.2
50 0.19
51 0.18
52 0.17
53 0.13
54 0.1
55 0.08
56 0.08
57 0.09
58 0.08
59 0.07
60 0.07
61 0.08
62 0.11
63 0.12
64 0.12
65 0.11
66 0.11
67 0.13
68 0.17
69 0.17
70 0.22
71 0.26
72 0.34
73 0.4
74 0.46
75 0.52
76 0.56
77 0.65
78 0.69
79 0.74
80 0.76
81 0.8
82 0.81
83 0.81
84 0.73
85 0.64
86 0.59
87 0.53
88 0.48
89 0.45
90 0.43
91 0.4
92 0.45
93 0.51
94 0.49
95 0.53
96 0.56
97 0.56
98 0.62
99 0.66
100 0.71
101 0.74
102 0.78
103 0.74
104 0.67
105 0.66
106 0.57
107 0.51
108 0.41
109 0.31
110 0.23
111 0.22
112 0.2
113 0.14
114 0.13
115 0.09
116 0.1
117 0.16
118 0.17
119 0.19
120 0.27
121 0.35
122 0.46
123 0.51
124 0.55
125 0.57
126 0.56
127 0.59
128 0.59
129 0.53
130 0.49
131 0.48
132 0.5
133 0.49
134 0.48
135 0.44
136 0.38
137 0.36
138 0.35
139 0.36
140 0.33
141 0.38
142 0.47
143 0.52
144 0.58
145 0.6
146 0.61
147 0.65
148 0.66
149 0.64
150 0.63
151 0.64
152 0.65
153 0.63
154 0.6
155 0.53
156 0.5
157 0.44
158 0.37
159 0.32
160 0.23
161 0.22
162 0.2
163 0.18