Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H010

Protein Details
Accession A0A2I1H010   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MKEKGKIKGKSKMKGKVKRKGKVKQKERFSVPCSBasic
NLS Segment(s)
PositionSequence
3-27EKGKIKGKSKMKGKVKRKGKVKQKE
Subcellular Location(s) nucl 11, cyto_nucl 10.5, mito 8, cyto 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKEKGKIKGKSKMKGKVKRKGKVKQKERFSVPCSSSYEGFSGKFPFLAVLLAKGFSSSLHFTEMILVLCDSIGRSLSNGAVVVRLIAPAIAPARRYFRSYSKISGPQTWFDLVYNTKGGFFLVLFQGSLVLFTNSYRFLFFAGREGSPKTKKTPRSSLRFFEYTVFISNDFYGLTGKMSNIDINSESLSDNGISRDATPHVSEPEDIPQQSSRNYKSVVLVVFLTDRIKSNQIWDLIESNQARFGIRIRFDSTNRQSFLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.87
4 0.88
5 0.87
6 0.88
7 0.88
8 0.88
9 0.88
10 0.89
11 0.88
12 0.88
13 0.88
14 0.86
15 0.85
16 0.78
17 0.76
18 0.68
19 0.64
20 0.59
21 0.52
22 0.45
23 0.38
24 0.36
25 0.29
26 0.27
27 0.24
28 0.22
29 0.19
30 0.17
31 0.15
32 0.13
33 0.11
34 0.13
35 0.11
36 0.1
37 0.1
38 0.11
39 0.1
40 0.1
41 0.1
42 0.08
43 0.11
44 0.11
45 0.12
46 0.14
47 0.14
48 0.14
49 0.17
50 0.18
51 0.14
52 0.12
53 0.11
54 0.08
55 0.08
56 0.08
57 0.06
58 0.05
59 0.06
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.04
74 0.04
75 0.05
76 0.07
77 0.07
78 0.08
79 0.1
80 0.15
81 0.17
82 0.2
83 0.22
84 0.26
85 0.32
86 0.34
87 0.36
88 0.38
89 0.44
90 0.43
91 0.46
92 0.42
93 0.37
94 0.36
95 0.33
96 0.27
97 0.2
98 0.2
99 0.14
100 0.14
101 0.13
102 0.11
103 0.11
104 0.1
105 0.1
106 0.08
107 0.07
108 0.06
109 0.06
110 0.06
111 0.05
112 0.05
113 0.06
114 0.05
115 0.06
116 0.05
117 0.04
118 0.04
119 0.05
120 0.06
121 0.06
122 0.07
123 0.07
124 0.06
125 0.08
126 0.09
127 0.09
128 0.12
129 0.13
130 0.13
131 0.15
132 0.17
133 0.21
134 0.24
135 0.27
136 0.29
137 0.35
138 0.43
139 0.49
140 0.58
141 0.6
142 0.65
143 0.69
144 0.67
145 0.66
146 0.59
147 0.53
148 0.44
149 0.37
150 0.29
151 0.26
152 0.21
153 0.15
154 0.15
155 0.14
156 0.12
157 0.1
158 0.09
159 0.07
160 0.06
161 0.07
162 0.06
163 0.06
164 0.08
165 0.08
166 0.09
167 0.09
168 0.1
169 0.1
170 0.11
171 0.11
172 0.11
173 0.1
174 0.09
175 0.1
176 0.08
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.1
183 0.11
184 0.13
185 0.13
186 0.15
187 0.16
188 0.17
189 0.17
190 0.17
191 0.21
192 0.23
193 0.22
194 0.22
195 0.23
196 0.24
197 0.29
198 0.34
199 0.32
200 0.32
201 0.34
202 0.33
203 0.33
204 0.35
205 0.31
206 0.26
207 0.22
208 0.19
209 0.18
210 0.18
211 0.16
212 0.12
213 0.14
214 0.16
215 0.18
216 0.18
217 0.21
218 0.26
219 0.28
220 0.28
221 0.28
222 0.28
223 0.26
224 0.33
225 0.29
226 0.24
227 0.25
228 0.24
229 0.22
230 0.21
231 0.24
232 0.25
233 0.27
234 0.3
235 0.33
236 0.38
237 0.41
238 0.51
239 0.55
240 0.56