Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HBW5

Protein Details
Accession A0A2I1HBW5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-104VIGTVCYCKRDKKPRNNSGHGMNAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, vacu 4, extr 3, pero 3, E.R. 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MILITTTNLLNDSLQRIITKYSIILLLLLNILINNNSSGFGVLGDTGSEENDNNNTKGVQLKYQIPIGLGIGCAAVIIIIVIGTVCYCKRDKKPRNNSGHGMNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.17
5 0.16
6 0.15
7 0.12
8 0.12
9 0.12
10 0.11
11 0.11
12 0.09
13 0.08
14 0.08
15 0.07
16 0.06
17 0.05
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.08
39 0.1
40 0.09
41 0.1
42 0.1
43 0.1
44 0.14
45 0.15
46 0.15
47 0.16
48 0.2
49 0.21
50 0.23
51 0.22
52 0.18
53 0.18
54 0.15
55 0.13
56 0.09
57 0.07
58 0.05
59 0.05
60 0.04
61 0.04
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.04
72 0.05
73 0.08
74 0.11
75 0.19
76 0.3
77 0.41
78 0.52
79 0.62
80 0.73
81 0.81
82 0.89
83 0.89
84 0.85