Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GB05

Protein Details
Accession A0A2I1GB05   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28AVGTGEKKQKKKEELQKEDKKRTEERBasic
114-134IINKQRNGKKKEEKIPYQRFEHydrophilic
NLS Segment(s)
PositionSequence
9-15KKQKKKE
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAAVGTGEKKQKKKEELQKEDKKRTEERQDEHDEENLIEPLFETPPQKVFSELDGISHTVDDGGKSMPITEDAVVDTINRFRKGIDDEVKEDNKVTDKKLQKGNVSTAEEVVNIINKQRNGKKKEEKIPYQRFELSPLFSEENEAGSKLSSKEHKFLKLVIPSVPKGSGQTRVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.83
4 0.87
5 0.89
6 0.9
7 0.92
8 0.87
9 0.83
10 0.79
11 0.78
12 0.78
13 0.76
14 0.7
15 0.68
16 0.7
17 0.68
18 0.62
19 0.54
20 0.44
21 0.36
22 0.33
23 0.25
24 0.17
25 0.13
26 0.11
27 0.1
28 0.1
29 0.11
30 0.11
31 0.11
32 0.14
33 0.17
34 0.17
35 0.18
36 0.18
37 0.17
38 0.21
39 0.2
40 0.18
41 0.17
42 0.17
43 0.15
44 0.14
45 0.12
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.09
65 0.12
66 0.13
67 0.13
68 0.12
69 0.15
70 0.18
71 0.25
72 0.27
73 0.26
74 0.29
75 0.33
76 0.34
77 0.31
78 0.28
79 0.22
80 0.21
81 0.2
82 0.19
83 0.23
84 0.27
85 0.33
86 0.39
87 0.43
88 0.42
89 0.44
90 0.47
91 0.45
92 0.43
93 0.38
94 0.32
95 0.28
96 0.23
97 0.2
98 0.16
99 0.11
100 0.08
101 0.11
102 0.13
103 0.14
104 0.21
105 0.29
106 0.38
107 0.41
108 0.52
109 0.6
110 0.66
111 0.74
112 0.77
113 0.79
114 0.81
115 0.86
116 0.79
117 0.73
118 0.68
119 0.59
120 0.55
121 0.48
122 0.39
123 0.31
124 0.31
125 0.28
126 0.23
127 0.25
128 0.2
129 0.19
130 0.18
131 0.16
132 0.12
133 0.11
134 0.13
135 0.12
136 0.17
137 0.23
138 0.26
139 0.33
140 0.39
141 0.44
142 0.44
143 0.47
144 0.49
145 0.48
146 0.46
147 0.45
148 0.45
149 0.41
150 0.42
151 0.4
152 0.32
153 0.31
154 0.32