Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FUF5

Protein Details
Accession A0A2I1FUF5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-60GDRFTAKKINQRYKNKVNPLLRHydrophilic
110-134QIKNFWHTQERKKKRNTSQGINHDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 13.833, mito_nucl 13.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
Amino Acid Sequences MANQSRIRFRQEDDDNIKKYMEEFGHLPNRYALISEKMGDRFTAKKINQRYKNKVNPLLRDDPFNDNEKSFINKWVKDYKILNPSSKSISWKEFIPVMEEKFGKLRSENQIKNFWHTQERKKKRNTSQGINHDISYSPQYNNEIKRDPKMEISHLTNDEIKRDPKMEVSHLTNDEIKRDPKMEVSHLIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.56
4 0.53
5 0.42
6 0.37
7 0.34
8 0.26
9 0.21
10 0.2
11 0.27
12 0.36
13 0.36
14 0.36
15 0.31
16 0.31
17 0.28
18 0.27
19 0.21
20 0.17
21 0.18
22 0.18
23 0.21
24 0.21
25 0.21
26 0.21
27 0.21
28 0.19
29 0.22
30 0.29
31 0.28
32 0.35
33 0.44
34 0.54
35 0.62
36 0.69
37 0.75
38 0.76
39 0.83
40 0.84
41 0.83
42 0.79
43 0.76
44 0.73
45 0.72
46 0.62
47 0.56
48 0.5
49 0.46
50 0.42
51 0.39
52 0.33
53 0.25
54 0.25
55 0.23
56 0.24
57 0.2
58 0.26
59 0.27
60 0.27
61 0.32
62 0.38
63 0.38
64 0.38
65 0.4
66 0.38
67 0.42
68 0.43
69 0.42
70 0.37
71 0.37
72 0.36
73 0.35
74 0.32
75 0.26
76 0.25
77 0.23
78 0.22
79 0.21
80 0.2
81 0.19
82 0.19
83 0.18
84 0.16
85 0.18
86 0.17
87 0.16
88 0.16
89 0.17
90 0.14
91 0.14
92 0.18
93 0.24
94 0.33
95 0.36
96 0.38
97 0.45
98 0.45
99 0.49
100 0.46
101 0.4
102 0.4
103 0.43
104 0.49
105 0.52
106 0.62
107 0.65
108 0.72
109 0.8
110 0.8
111 0.85
112 0.82
113 0.81
114 0.81
115 0.81
116 0.79
117 0.7
118 0.61
119 0.51
120 0.43
121 0.35
122 0.3
123 0.23
124 0.17
125 0.17
126 0.21
127 0.26
128 0.3
129 0.34
130 0.35
131 0.36
132 0.42
133 0.43
134 0.4
135 0.42
136 0.41
137 0.41
138 0.39
139 0.41
140 0.41
141 0.4
142 0.4
143 0.38
144 0.35
145 0.34
146 0.33
147 0.31
148 0.28
149 0.28
150 0.27
151 0.28
152 0.32
153 0.34
154 0.35
155 0.38
156 0.42
157 0.42
158 0.43
159 0.43
160 0.39
161 0.38
162 0.36
163 0.33
164 0.3
165 0.3
166 0.28
167 0.29
168 0.33
169 0.34