Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NHJ7

Protein Details
Accession J3NHJ7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
134-158VTKDKEPKSKKSKGREKASSSKTKEBasic
NLS Segment(s)
PositionSequence
138-152KEPKSKKSKGREKAS
Subcellular Location(s) cyto 11.5, cyto_mito 10.666, cyto_nucl 8.833, mito 8.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MTRAALCPGKAVSIADEACMHLLSYLLREGDGRLPASPLPYTLTWTAGHVYATESYRVLRVFRLPLFRKVEERERTEGLPQGNTDAKKDYVSDSADDAAEESIPVAFISNAKIFLPRSAVQRSVHLFPSADEEVTKDKEPKSKKSKGREKASSSKTKETGDDDKVVATVVVSPEDSLAGVAHPYVGPPQVVLAVSAGQTPQTSLTRFSSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.16
5 0.16
6 0.16
7 0.13
8 0.08
9 0.08
10 0.07
11 0.08
12 0.1
13 0.09
14 0.1
15 0.1
16 0.12
17 0.16
18 0.18
19 0.17
20 0.16
21 0.17
22 0.18
23 0.2
24 0.18
25 0.15
26 0.16
27 0.15
28 0.18
29 0.17
30 0.19
31 0.17
32 0.18
33 0.18
34 0.15
35 0.15
36 0.11
37 0.12
38 0.13
39 0.14
40 0.13
41 0.12
42 0.12
43 0.14
44 0.15
45 0.14
46 0.13
47 0.15
48 0.19
49 0.22
50 0.31
51 0.32
52 0.39
53 0.45
54 0.45
55 0.46
56 0.46
57 0.53
58 0.5
59 0.51
60 0.47
61 0.44
62 0.43
63 0.4
64 0.39
65 0.3
66 0.25
67 0.2
68 0.19
69 0.2
70 0.2
71 0.19
72 0.18
73 0.17
74 0.16
75 0.17
76 0.15
77 0.15
78 0.15
79 0.15
80 0.13
81 0.13
82 0.13
83 0.12
84 0.1
85 0.07
86 0.06
87 0.05
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.06
96 0.06
97 0.07
98 0.07
99 0.09
100 0.09
101 0.1
102 0.14
103 0.14
104 0.18
105 0.2
106 0.23
107 0.22
108 0.26
109 0.28
110 0.26
111 0.26
112 0.22
113 0.2
114 0.17
115 0.22
116 0.18
117 0.15
118 0.13
119 0.13
120 0.15
121 0.18
122 0.19
123 0.16
124 0.18
125 0.25
126 0.3
127 0.39
128 0.46
129 0.53
130 0.6
131 0.68
132 0.76
133 0.79
134 0.84
135 0.83
136 0.82
137 0.83
138 0.83
139 0.82
140 0.77
141 0.74
142 0.68
143 0.6
144 0.55
145 0.5
146 0.48
147 0.43
148 0.39
149 0.32
150 0.29
151 0.27
152 0.25
153 0.18
154 0.12
155 0.09
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.08
162 0.08
163 0.06
164 0.06
165 0.05
166 0.05
167 0.05
168 0.06
169 0.05
170 0.06
171 0.08
172 0.09
173 0.08
174 0.08
175 0.09
176 0.1
177 0.11
178 0.1
179 0.1
180 0.09
181 0.1
182 0.1
183 0.1
184 0.09
185 0.09
186 0.09
187 0.12
188 0.15
189 0.16
190 0.2
191 0.25