Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HR29

Protein Details
Accession A0A2I1HR29    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
56-75KGPGKGKKAPKEPPKGPPKEBasic
225-245STDHCKDGSMRKRDEKRDEIPBasic
NLS Segment(s)
PositionSequence
56-202KGPGKGKKAPKEPPKGPPKEPKAPPPPPPPPPKAPPKEPPKAPPPPPPPPPKTPPPPKEPPKGPPPPPPPPPPKEPPKEPPPPPPPPSPKEPLPKAPDGGKGPLPPPPPSPPPKEPPKVPAPAPAPAPAPKAPPPKEPPKTPPPPPP
Subcellular Location(s) extr 11, golg 7, E.R. 4, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLYILFRNRNKLILIITLIILFIAVNFAFPAYKSTNSIGNTLHKRQGPDGADDDGKGPGKGKKAPKEPPKGPPKEPKAPPPPPPPPPKAPPKEPPKAPPPPPPPPPKTPPPPKEPPKGPPPPPPPPPPKEPPKEPPPPPPPPSPKEPLPKAPDGGKGPLPPPPPSPPPKEPPKVPAPAPAPAPAPKAPPPKEPPKTPPPPPPPPPDNVPHPQPDVGKFVVNKSNSTDHCKDGSMRKRDEKRDEIPDGNCGAWFKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.22
4 0.19
5 0.17
6 0.14
7 0.11
8 0.07
9 0.05
10 0.06
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.07
17 0.12
18 0.13
19 0.15
20 0.18
21 0.2
22 0.26
23 0.27
24 0.29
25 0.27
26 0.33
27 0.38
28 0.4
29 0.45
30 0.41
31 0.43
32 0.42
33 0.47
34 0.4
35 0.38
36 0.36
37 0.33
38 0.31
39 0.29
40 0.28
41 0.23
42 0.21
43 0.17
44 0.17
45 0.17
46 0.21
47 0.28
48 0.36
49 0.42
50 0.51
51 0.6
52 0.68
53 0.75
54 0.76
55 0.78
56 0.8
57 0.78
58 0.77
59 0.77
60 0.75
61 0.75
62 0.73
63 0.73
64 0.73
65 0.73
66 0.74
67 0.73
68 0.72
69 0.71
70 0.74
71 0.7
72 0.67
73 0.68
74 0.7
75 0.67
76 0.66
77 0.67
78 0.68
79 0.7
80 0.68
81 0.66
82 0.65
83 0.67
84 0.65
85 0.66
86 0.65
87 0.64
88 0.68
89 0.71
90 0.68
91 0.66
92 0.67
93 0.65
94 0.67
95 0.69
96 0.67
97 0.66
98 0.7
99 0.7
100 0.73
101 0.7
102 0.65
103 0.65
104 0.67
105 0.64
106 0.64
107 0.64
108 0.64
109 0.64
110 0.67
111 0.65
112 0.61
113 0.62
114 0.59
115 0.61
116 0.59
117 0.6
118 0.59
119 0.6
120 0.64
121 0.61
122 0.64
123 0.63
124 0.64
125 0.62
126 0.64
127 0.62
128 0.57
129 0.6
130 0.55
131 0.54
132 0.55
133 0.55
134 0.54
135 0.52
136 0.5
137 0.47
138 0.44
139 0.42
140 0.36
141 0.35
142 0.29
143 0.26
144 0.24
145 0.27
146 0.27
147 0.24
148 0.26
149 0.28
150 0.33
151 0.37
152 0.44
153 0.45
154 0.5
155 0.57
156 0.59
157 0.57
158 0.56
159 0.58
160 0.55
161 0.5
162 0.5
163 0.43
164 0.41
165 0.4
166 0.35
167 0.31
168 0.28
169 0.32
170 0.25
171 0.27
172 0.31
173 0.39
174 0.4
175 0.46
176 0.51
177 0.57
178 0.63
179 0.65
180 0.66
181 0.67
182 0.72
183 0.71
184 0.74
185 0.73
186 0.75
187 0.75
188 0.76
189 0.7
190 0.66
191 0.64
192 0.59
193 0.58
194 0.54
195 0.52
196 0.48
197 0.47
198 0.46
199 0.44
200 0.41
201 0.38
202 0.33
203 0.33
204 0.29
205 0.31
206 0.34
207 0.32
208 0.31
209 0.31
210 0.38
211 0.37
212 0.45
213 0.43
214 0.4
215 0.41
216 0.41
217 0.42
218 0.44
219 0.51
220 0.51
221 0.56
222 0.62
223 0.7
224 0.77
225 0.82
226 0.8
227 0.78
228 0.78
229 0.77
230 0.73
231 0.65
232 0.6
233 0.53
234 0.45
235 0.38