Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H852

Protein Details
Accession A0A2I1H852    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGKASNKKSIRSRKLSKSRCKIPNAFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MGKASNKKSIRSRKLSKSRCKIPNAFIIFSNEFYNKYYRTKKAKRTIVMKSAQSAWNSMSAQEKIPYRYQYEQLKKSRANCNPCNEIIFVLNENKNDQYNKLENIDDQYNKLENIDDQCNKLFEEFINQEMLEDWISP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.9
4 0.9
5 0.9
6 0.88
7 0.87
8 0.82
9 0.77
10 0.76
11 0.71
12 0.62
13 0.53
14 0.51
15 0.44
16 0.39
17 0.36
18 0.27
19 0.22
20 0.22
21 0.24
22 0.2
23 0.26
24 0.32
25 0.38
26 0.48
27 0.56
28 0.65
29 0.71
30 0.78
31 0.77
32 0.78
33 0.77
34 0.74
35 0.71
36 0.61
37 0.53
38 0.48
39 0.44
40 0.37
41 0.3
42 0.22
43 0.2
44 0.19
45 0.18
46 0.17
47 0.15
48 0.15
49 0.17
50 0.19
51 0.18
52 0.21
53 0.22
54 0.23
55 0.24
56 0.29
57 0.35
58 0.41
59 0.46
60 0.48
61 0.52
62 0.51
63 0.55
64 0.59
65 0.57
66 0.59
67 0.56
68 0.57
69 0.55
70 0.53
71 0.49
72 0.4
73 0.33
74 0.26
75 0.21
76 0.16
77 0.17
78 0.18
79 0.17
80 0.18
81 0.18
82 0.2
83 0.2
84 0.2
85 0.22
86 0.24
87 0.26
88 0.27
89 0.26
90 0.24
91 0.28
92 0.32
93 0.26
94 0.24
95 0.25
96 0.24
97 0.23
98 0.23
99 0.19
100 0.16
101 0.2
102 0.26
103 0.25
104 0.27
105 0.29
106 0.29
107 0.29
108 0.27
109 0.23
110 0.15
111 0.22
112 0.21
113 0.2
114 0.22
115 0.21
116 0.21
117 0.2
118 0.21