Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H2P7

Protein Details
Accession A0A2I1H2P7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
110-140KEAYKYRTEKFPKKVKRRRKKEPWNANIAFQHydrophilic
NLS Segment(s)
PositionSequence
114-131KYRTEKFPKKVKRRRKKE
Subcellular Location(s) nucl 16.5, cyto_nucl 10.333, mito 6.5, cyto_mito 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
Amino Acid Sequences MTYQNTSLRACVFIDSSNPELPNQIMNHSSHPFIKPPFPPLIDPKDLLIISKDNKPSRSPNAFIIYRKVFLKTTRDQGYFLPMTIVSSMASKSWDKESDEVRDYYKKLAKEAYKYRTEKFPKKVKRRRKKEPWNANIAFQNDLHNTFFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.23
4 0.25
5 0.25
6 0.23
7 0.23
8 0.23
9 0.25
10 0.21
11 0.2
12 0.19
13 0.2
14 0.25
15 0.25
16 0.26
17 0.24
18 0.25
19 0.27
20 0.27
21 0.32
22 0.29
23 0.32
24 0.35
25 0.34
26 0.35
27 0.37
28 0.41
29 0.38
30 0.36
31 0.32
32 0.31
33 0.29
34 0.26
35 0.21
36 0.18
37 0.17
38 0.22
39 0.28
40 0.27
41 0.3
42 0.33
43 0.37
44 0.42
45 0.45
46 0.42
47 0.4
48 0.43
49 0.44
50 0.41
51 0.41
52 0.34
53 0.31
54 0.29
55 0.26
56 0.21
57 0.21
58 0.27
59 0.24
60 0.3
61 0.33
62 0.33
63 0.32
64 0.31
65 0.34
66 0.28
67 0.24
68 0.18
69 0.12
70 0.12
71 0.11
72 0.11
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.08
79 0.1
80 0.13
81 0.16
82 0.17
83 0.2
84 0.24
85 0.27
86 0.29
87 0.29
88 0.28
89 0.3
90 0.29
91 0.32
92 0.33
93 0.28
94 0.27
95 0.34
96 0.36
97 0.41
98 0.49
99 0.5
100 0.55
101 0.57
102 0.58
103 0.61
104 0.65
105 0.66
106 0.66
107 0.7
108 0.71
109 0.79
110 0.87
111 0.88
112 0.9
113 0.92
114 0.94
115 0.94
116 0.95
117 0.95
118 0.96
119 0.93
120 0.92
121 0.84
122 0.78
123 0.72
124 0.63
125 0.54
126 0.43
127 0.4
128 0.31
129 0.32