Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GNZ8

Protein Details
Accession A0A2I1GNZ8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-31GESSEAKPSKGKKKSKSGKTSVQKPPMTHydrophilic
NLS Segment(s)
PositionSequence
10-23KPSKGKKKSKSGKT
Subcellular Location(s) nucl 15.5, mito_nucl 11, mito 5.5, pero 4
Family & Domain DBs
Amino Acid Sequences MKLGESSEAKPSKGKKKSKSGKTSVQKPPMTIHAIIYKKKVPAKSVIAGHMISQENQDGPMGLYANIRWFPGKWALPERKWRETFQAVVENADSMHQFELWKRRYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.71
4 0.8
5 0.85
6 0.87
7 0.85
8 0.86
9 0.86
10 0.87
11 0.85
12 0.85
13 0.75
14 0.67
15 0.61
16 0.56
17 0.5
18 0.4
19 0.33
20 0.31
21 0.33
22 0.34
23 0.34
24 0.32
25 0.33
26 0.37
27 0.37
28 0.31
29 0.33
30 0.36
31 0.38
32 0.37
33 0.34
34 0.31
35 0.29
36 0.27
37 0.24
38 0.2
39 0.15
40 0.13
41 0.12
42 0.1
43 0.1
44 0.09
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.09
53 0.09
54 0.1
55 0.1
56 0.1
57 0.12
58 0.18
59 0.21
60 0.22
61 0.31
62 0.38
63 0.43
64 0.53
65 0.58
66 0.6
67 0.62
68 0.6
69 0.59
70 0.56
71 0.53
72 0.47
73 0.48
74 0.39
75 0.37
76 0.35
77 0.27
78 0.22
79 0.21
80 0.16
81 0.1
82 0.1
83 0.09
84 0.1
85 0.16
86 0.26