Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GGA6

Protein Details
Accession A0A2I1GGA6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRLQRRKNLRYTPRPQNPFMHydrophilic
NLS Segment(s)
PositionSequence
83-85RKK
Subcellular Location(s) nucl 23, mito_nucl 13.833, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MRLQRRKNLRYTPRPQNPFMLYRRDMAAKSEFVGLKSSEVSKKIGMMWKNETTEVKDLFNAMARLAEKRHSEKYSDYSYTPKRKKKESQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.78
3 0.74
4 0.68
5 0.65
6 0.59
7 0.56
8 0.47
9 0.43
10 0.43
11 0.38
12 0.33
13 0.29
14 0.29
15 0.21
16 0.2
17 0.23
18 0.21
19 0.19
20 0.2
21 0.17
22 0.14
23 0.15
24 0.16
25 0.14
26 0.15
27 0.15
28 0.13
29 0.14
30 0.15
31 0.19
32 0.19
33 0.2
34 0.24
35 0.27
36 0.27
37 0.28
38 0.27
39 0.25
40 0.27
41 0.25
42 0.2
43 0.17
44 0.16
45 0.15
46 0.17
47 0.14
48 0.1
49 0.11
50 0.11
51 0.13
52 0.14
53 0.19
54 0.21
55 0.26
56 0.33
57 0.33
58 0.35
59 0.38
60 0.43
61 0.45
62 0.43
63 0.4
64 0.42
65 0.49
66 0.57
67 0.63
68 0.65
69 0.66