Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GND7

Protein Details
Accession A0A2I1GND7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-111VNVLWVKKVKNTKKKKNKDEIKEKMEEWHydrophilic
NLS Segment(s)
PositionSequence
52-102KKKLANNHSVKAEKDERNEKKIKGENKNEKANVNVLWVKKVKNTKKKKNKD
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIPFNENKNNQDRQNNLNELEQNRKLIYQESWVLKLECLQCYERFERFERWKKKLANNHSVKAEKDERNEKKIKGENKNEKANVNVLWVKKVKNTKKKKNKDEIKEKMEEWMIERMEDNEWLREWMDGVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.53
4 0.5
5 0.49
6 0.45
7 0.48
8 0.44
9 0.38
10 0.34
11 0.33
12 0.29
13 0.26
14 0.24
15 0.21
16 0.25
17 0.26
18 0.27
19 0.28
20 0.28
21 0.25
22 0.29
23 0.27
24 0.22
25 0.22
26 0.23
27 0.23
28 0.27
29 0.31
30 0.29
31 0.29
32 0.3
33 0.36
34 0.43
35 0.51
36 0.54
37 0.56
38 0.61
39 0.64
40 0.69
41 0.7
42 0.69
43 0.7
44 0.67
45 0.66
46 0.63
47 0.58
48 0.51
49 0.47
50 0.45
51 0.38
52 0.36
53 0.43
54 0.41
55 0.46
56 0.5
57 0.46
58 0.46
59 0.49
60 0.53
61 0.53
62 0.59
63 0.63
64 0.66
65 0.73
66 0.67
67 0.62
68 0.55
69 0.47
70 0.37
71 0.31
72 0.28
73 0.21
74 0.24
75 0.25
76 0.25
77 0.28
78 0.37
79 0.43
80 0.49
81 0.6
82 0.66
83 0.76
84 0.86
85 0.91
86 0.92
87 0.92
88 0.93
89 0.93
90 0.92
91 0.88
92 0.81
93 0.71
94 0.65
95 0.57
96 0.47
97 0.38
98 0.35
99 0.28
100 0.24
101 0.24
102 0.21
103 0.2
104 0.23
105 0.22
106 0.18
107 0.19
108 0.2
109 0.19
110 0.18
111 0.17