Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HIT2

Protein Details
Accession A0A2I1HIT2   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKWFCLKKKSKKRAKAKNCTNSMGPHydrophilic
NLS Segment(s)
PositionSequence
8-18KKKSKKRAKAK
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_nucl 3.166, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036465  vWFA_dom_sf  
Amino Acid Sequences MSKWFCLKKKSKKRAKAKNCTNSMGPYIAAARDYILQSVLPYGGGDTPEDVLGGLNEAITKMNWKNGTRVLLHIGDSPPHVDNIFIGYPWNEKLSFPLFSNSRRNPNNKLSENIFVILEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.94
4 0.94
5 0.93
6 0.89
7 0.83
8 0.75
9 0.67
10 0.58
11 0.48
12 0.36
13 0.27
14 0.22
15 0.18
16 0.15
17 0.11
18 0.09
19 0.1
20 0.1
21 0.09
22 0.09
23 0.08
24 0.08
25 0.09
26 0.08
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.04
40 0.05
41 0.04
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.07
48 0.06
49 0.11
50 0.15
51 0.16
52 0.18
53 0.21
54 0.25
55 0.23
56 0.24
57 0.24
58 0.21
59 0.21
60 0.21
61 0.18
62 0.15
63 0.15
64 0.16
65 0.12
66 0.12
67 0.11
68 0.09
69 0.08
70 0.12
71 0.11
72 0.09
73 0.1
74 0.1
75 0.12
76 0.13
77 0.15
78 0.11
79 0.11
80 0.15
81 0.18
82 0.19
83 0.19
84 0.24
85 0.25
86 0.31
87 0.41
88 0.43
89 0.49
90 0.54
91 0.59
92 0.61
93 0.67
94 0.72
95 0.66
96 0.66
97 0.61
98 0.59
99 0.56
100 0.49