Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H2Z8

Protein Details
Accession A0A2I1H2Z8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
112-139VLSDNKSDKKNHKKKKKKYNLDNKAANLHydrophilic
NLS Segment(s)
PositionSequence
119-129DKKNHKKKKKK
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MNISSVNLNSNNNTVLVIEEKGALILYLYSDNEEGQKPKYQAQYCTRNEETYVYIQLLGECNGKKRLHKGELLPVKKNLRLFEGLPEGPPKGPPERLGPVKENLGFEKFEEVLSDNKSDKKNHKKKKKKYNLDNKAANLGKDLHEILQFIHKLPTYSPIRDKKNFLPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.11
6 0.1
7 0.1
8 0.1
9 0.1
10 0.08
11 0.06
12 0.05
13 0.05
14 0.07
15 0.07
16 0.08
17 0.08
18 0.09
19 0.11
20 0.14
21 0.15
22 0.16
23 0.22
24 0.23
25 0.28
26 0.36
27 0.38
28 0.44
29 0.5
30 0.58
31 0.55
32 0.62
33 0.58
34 0.5
35 0.48
36 0.41
37 0.35
38 0.27
39 0.25
40 0.17
41 0.15
42 0.14
43 0.14
44 0.13
45 0.11
46 0.12
47 0.11
48 0.14
49 0.2
50 0.21
51 0.23
52 0.29
53 0.36
54 0.37
55 0.41
56 0.41
57 0.44
58 0.52
59 0.54
60 0.5
61 0.46
62 0.45
63 0.42
64 0.42
65 0.33
66 0.27
67 0.25
68 0.23
69 0.21
70 0.23
71 0.21
72 0.19
73 0.19
74 0.17
75 0.15
76 0.16
77 0.15
78 0.13
79 0.14
80 0.15
81 0.19
82 0.25
83 0.29
84 0.31
85 0.31
86 0.31
87 0.33
88 0.33
89 0.29
90 0.25
91 0.23
92 0.2
93 0.17
94 0.18
95 0.15
96 0.13
97 0.12
98 0.12
99 0.13
100 0.14
101 0.16
102 0.15
103 0.2
104 0.24
105 0.28
106 0.37
107 0.46
108 0.55
109 0.64
110 0.74
111 0.8
112 0.87
113 0.93
114 0.94
115 0.94
116 0.94
117 0.95
118 0.94
119 0.93
120 0.9
121 0.8
122 0.78
123 0.68
124 0.57
125 0.48
126 0.39
127 0.31
128 0.27
129 0.26
130 0.19
131 0.18
132 0.18
133 0.16
134 0.22
135 0.21
136 0.19
137 0.22
138 0.21
139 0.22
140 0.22
141 0.3
142 0.28
143 0.34
144 0.43
145 0.48
146 0.56
147 0.61
148 0.67