Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H0E5

Protein Details
Accession A0A2I1H0E5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-83AAHDRRRYEYRLRRERRRSRSRSRSRSRSRSRDRRRDRSRDRRRDRSRDRRRDRKVEAGPHIEBasic
NLS Segment(s)
PositionSequence
23-76HDRRRYEYRLRRERRRSRSRSRSRSRSRSRDRRRDRSRDRRRDRSRDRRRDRKV
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MNDEFWLQTDLFRREYRRQHAAHDRRRYEYRLRRERRRSRSRSRSRSRSRSRDRRRDRSRDRRRDRSRDRRRDRKVEAGPHIEDKDIIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.51
3 0.55
4 0.57
5 0.55
6 0.6
7 0.67
8 0.72
9 0.73
10 0.74
11 0.7
12 0.68
13 0.7
14 0.66
15 0.66
16 0.65
17 0.66
18 0.66
19 0.71
20 0.76
21 0.82
22 0.88
23 0.88
24 0.9
25 0.88
26 0.88
27 0.91
28 0.91
29 0.91
30 0.9
31 0.9
32 0.89
33 0.91
34 0.9
35 0.89
36 0.89
37 0.9
38 0.91
39 0.91
40 0.91
41 0.92
42 0.92
43 0.92
44 0.92
45 0.92
46 0.93
47 0.93
48 0.93
49 0.93
50 0.93
51 0.93
52 0.93
53 0.93
54 0.93
55 0.93
56 0.94
57 0.94
58 0.93
59 0.92
60 0.89
61 0.88
62 0.85
63 0.84
64 0.81
65 0.77
66 0.7
67 0.66
68 0.6
69 0.5
70 0.42