Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GKT0

Protein Details
Accession A0A2I1GKT0    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-86LGSIERYRRRFRRRVNRIFRQRHNLVHydrophilic
NLS Segment(s)
PositionSequence
69-74RRFRRR
Subcellular Location(s) nucl 21, mito 3, pero 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
Amino Acid Sequences MNTNQQNRQFRQFPRQPWNDREDTNLTFLVDFIGINWARISIVLGRSALQCRRRYLRLLALGSIERYRRRFRRRVNRIFRQRHNLVSFRGFFQGIQLLARQNIIPTRDYRMDLNHILNTSQDHRMNINYILSVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.76
4 0.74
5 0.76
6 0.7
7 0.62
8 0.59
9 0.55
10 0.47
11 0.42
12 0.36
13 0.29
14 0.24
15 0.22
16 0.17
17 0.11
18 0.09
19 0.06
20 0.12
21 0.11
22 0.12
23 0.12
24 0.11
25 0.11
26 0.11
27 0.12
28 0.08
29 0.09
30 0.1
31 0.11
32 0.11
33 0.13
34 0.17
35 0.22
36 0.26
37 0.28
38 0.32
39 0.37
40 0.39
41 0.41
42 0.41
43 0.42
44 0.42
45 0.4
46 0.35
47 0.32
48 0.29
49 0.27
50 0.24
51 0.2
52 0.16
53 0.19
54 0.26
55 0.33
56 0.41
57 0.49
58 0.58
59 0.67
60 0.74
61 0.82
62 0.85
63 0.87
64 0.89
65 0.9
66 0.86
67 0.83
68 0.75
69 0.71
70 0.66
71 0.58
72 0.5
73 0.46
74 0.41
75 0.34
76 0.32
77 0.25
78 0.2
79 0.19
80 0.18
81 0.13
82 0.13
83 0.12
84 0.12
85 0.12
86 0.13
87 0.12
88 0.11
89 0.14
90 0.15
91 0.16
92 0.16
93 0.23
94 0.25
95 0.27
96 0.27
97 0.28
98 0.32
99 0.34
100 0.36
101 0.32
102 0.3
103 0.28
104 0.27
105 0.27
106 0.25
107 0.28
108 0.27
109 0.26
110 0.27
111 0.3
112 0.32
113 0.3
114 0.28