Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H363

Protein Details
Accession A0A2I1H363    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-90ENSTKATKISADKKKKKKKKNRNYRKBasic
NLS Segment(s)
PositionSequence
70-90ATKISADKKKKKKKKNRNYRK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences RLYTTLNDGFEQRLKDENRYQDKKEIGDKRPIFDSPKKSETSGSSESESEAEDIKPYVLESKKGENSTKATKISADKKKKKKKKNRNYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.39
4 0.45
5 0.52
6 0.56
7 0.58
8 0.57
9 0.58
10 0.55
11 0.58
12 0.57
13 0.5
14 0.55
15 0.53
16 0.49
17 0.48
18 0.47
19 0.43
20 0.42
21 0.45
22 0.41
23 0.44
24 0.43
25 0.41
26 0.41
27 0.38
28 0.37
29 0.33
30 0.28
31 0.25
32 0.23
33 0.23
34 0.21
35 0.18
36 0.12
37 0.09
38 0.08
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.12
45 0.12
46 0.15
47 0.17
48 0.24
49 0.3
50 0.33
51 0.35
52 0.33
53 0.38
54 0.42
55 0.44
56 0.39
57 0.35
58 0.35
59 0.41
60 0.47
61 0.52
62 0.56
63 0.62
64 0.71
65 0.82
66 0.89
67 0.92
68 0.93
69 0.94
70 0.94