Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8U9H9

Protein Details
Accession J8U9H9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-77ALATIQKAKRKRPKVRYYGYGELHydrophilic
NLS Segment(s)
PositionSequence
61-68KAKRKRPK
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
Amino Acid Sequences KAFKAKIISGPHKRTPGDTNILTFKKPVTCFKCGQLNHIVTICKIRTDNPKTPLALATIQKAKRKRPKVRYYGYGELSYIRPACPKKSKISLLNLIPLFGRLGTGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.54
4 0.52
5 0.45
6 0.42
7 0.43
8 0.44
9 0.4
10 0.35
11 0.3
12 0.29
13 0.31
14 0.37
15 0.35
16 0.38
17 0.4
18 0.44
19 0.51
20 0.44
21 0.46
22 0.45
23 0.4
24 0.36
25 0.36
26 0.32
27 0.24
28 0.28
29 0.23
30 0.17
31 0.16
32 0.18
33 0.26
34 0.33
35 0.39
36 0.39
37 0.42
38 0.41
39 0.41
40 0.38
41 0.3
42 0.25
43 0.2
44 0.19
45 0.22
46 0.26
47 0.3
48 0.34
49 0.41
50 0.48
51 0.58
52 0.65
53 0.69
54 0.77
55 0.81
56 0.84
57 0.83
58 0.81
59 0.78
60 0.7
61 0.6
62 0.5
63 0.42
64 0.35
65 0.31
66 0.23
67 0.16
68 0.19
69 0.21
70 0.29
71 0.36
72 0.4
73 0.45
74 0.53
75 0.61
76 0.62
77 0.68
78 0.68
79 0.62
80 0.66
81 0.58
82 0.49
83 0.41
84 0.35
85 0.27
86 0.18