Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HKY3

Protein Details
Accession A0A2I1HKY3    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-60FIRESPFQRRRRTIYNRKEPLYSGVARMKKKKERYNRERERERDVSHydrophilic
122-146VSGGYGREKKRKRNESREIRNQEEIHydrophilic
NLS Segment(s)
PositionSequence
40-56ARMKKKKERYNRERERE
129-134EKKRKR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MRNSRYSMQNSGEEFIRESPFQRRRRTIYNRKEPLYSGVARMKKKKERYNRERERERDVSGERYNRERERERDVSGECYNRERERERDVSGERYNRERERERDVSGERYNREQERERDVTHVSGGYGREKKRKRNESREIRNQEEITDLRSIVMELTDKIEELHRNRSRTRIPSASPNTSASIKKARNNLEPMNKDYKKFSGSVFVFISKFEKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.28
4 0.22
5 0.23
6 0.31
7 0.38
8 0.45
9 0.53
10 0.58
11 0.61
12 0.71
13 0.79
14 0.8
15 0.82
16 0.85
17 0.84
18 0.79
19 0.75
20 0.66
21 0.6
22 0.55
23 0.45
24 0.4
25 0.39
26 0.43
27 0.47
28 0.53
29 0.57
30 0.6
31 0.68
32 0.72
33 0.76
34 0.81
35 0.85
36 0.89
37 0.9
38 0.92
39 0.92
40 0.86
41 0.83
42 0.76
43 0.68
44 0.62
45 0.54
46 0.5
47 0.47
48 0.48
49 0.41
50 0.42
51 0.47
52 0.44
53 0.49
54 0.49
55 0.46
56 0.5
57 0.52
58 0.49
59 0.46
60 0.44
61 0.42
62 0.39
63 0.38
64 0.3
65 0.29
66 0.31
67 0.29
68 0.32
69 0.3
70 0.3
71 0.34
72 0.38
73 0.37
74 0.38
75 0.4
76 0.42
77 0.44
78 0.46
79 0.41
80 0.42
81 0.47
82 0.44
83 0.49
84 0.49
85 0.46
86 0.5
87 0.52
88 0.49
89 0.48
90 0.48
91 0.47
92 0.47
93 0.48
94 0.4
95 0.39
96 0.41
97 0.36
98 0.37
99 0.36
100 0.33
101 0.35
102 0.37
103 0.35
104 0.33
105 0.32
106 0.29
107 0.24
108 0.2
109 0.13
110 0.12
111 0.12
112 0.16
113 0.2
114 0.23
115 0.32
116 0.37
117 0.47
118 0.55
119 0.65
120 0.7
121 0.75
122 0.83
123 0.85
124 0.9
125 0.91
126 0.88
127 0.81
128 0.76
129 0.65
130 0.55
131 0.47
132 0.37
133 0.29
134 0.23
135 0.18
136 0.13
137 0.13
138 0.12
139 0.08
140 0.09
141 0.07
142 0.06
143 0.09
144 0.09
145 0.09
146 0.09
147 0.13
148 0.18
149 0.2
150 0.3
151 0.33
152 0.38
153 0.4
154 0.47
155 0.51
156 0.52
157 0.56
158 0.52
159 0.5
160 0.57
161 0.62
162 0.61
163 0.55
164 0.52
165 0.47
166 0.44
167 0.42
168 0.36
169 0.38
170 0.38
171 0.41
172 0.47
173 0.5
174 0.54
175 0.61
176 0.64
177 0.65
178 0.65
179 0.65
180 0.68
181 0.64
182 0.58
183 0.55
184 0.51
185 0.44
186 0.41
187 0.36
188 0.36
189 0.35
190 0.38
191 0.36
192 0.34
193 0.31
194 0.31