Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GSR2

Protein Details
Accession A0A2I1GSR2   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
161-181SDNTKVQRRLNSRQLARKRLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001063  Ribosomal_L22  
IPR018260  Ribosomal_L22/L17_CS  
IPR005721  Ribosomal_L22/L17_euk/arc  
IPR036394  Ribosomal_L22/L17_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00237  Ribosomal_L22  
PROSITE View protein in PROSITE  
PS00464  RIBOSOMAL_L22  
CDD cd00336  Ribosomal_L22  
Amino Acid Sequences MVRYSTEPKEATKYAKTRGSYLRVHFKNTRETAKAISGKKLTYAIKYLNDVKEHKQAVPFRRFHGGVGRCAQAKAFGHTQGRWPVKSAEFLLGLLKNVRSNAEVKELDIENLIISHIQVNQAPKQRRRTYRAHGRINPYMSSPCHIEIIVTEEAAQVKRESDNTKVQRRLNSRQLARKRLTASSQAQAQAQTQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.52
4 0.52
5 0.56
6 0.57
7 0.55
8 0.57
9 0.6
10 0.56
11 0.61
12 0.6
13 0.56
14 0.6
15 0.58
16 0.58
17 0.5
18 0.5
19 0.46
20 0.49
21 0.52
22 0.44
23 0.45
24 0.41
25 0.38
26 0.38
27 0.4
28 0.34
29 0.29
30 0.31
31 0.28
32 0.28
33 0.32
34 0.36
35 0.34
36 0.37
37 0.37
38 0.37
39 0.41
40 0.4
41 0.38
42 0.39
43 0.42
44 0.46
45 0.52
46 0.5
47 0.44
48 0.49
49 0.47
50 0.42
51 0.44
52 0.38
53 0.34
54 0.35
55 0.34
56 0.29
57 0.28
58 0.27
59 0.22
60 0.2
61 0.19
62 0.18
63 0.2
64 0.22
65 0.22
66 0.27
67 0.31
68 0.33
69 0.29
70 0.29
71 0.28
72 0.26
73 0.28
74 0.25
75 0.18
76 0.15
77 0.15
78 0.15
79 0.13
80 0.12
81 0.11
82 0.1
83 0.09
84 0.09
85 0.09
86 0.08
87 0.1
88 0.11
89 0.16
90 0.16
91 0.15
92 0.18
93 0.17
94 0.16
95 0.15
96 0.14
97 0.07
98 0.07
99 0.07
100 0.04
101 0.04
102 0.05
103 0.05
104 0.06
105 0.08
106 0.11
107 0.16
108 0.24
109 0.31
110 0.37
111 0.46
112 0.54
113 0.61
114 0.65
115 0.68
116 0.7
117 0.75
118 0.78
119 0.78
120 0.76
121 0.75
122 0.75
123 0.69
124 0.6
125 0.51
126 0.44
127 0.35
128 0.31
129 0.26
130 0.21
131 0.19
132 0.18
133 0.16
134 0.12
135 0.17
136 0.15
137 0.12
138 0.11
139 0.11
140 0.13
141 0.14
142 0.14
143 0.1
144 0.11
145 0.12
146 0.17
147 0.19
148 0.23
149 0.32
150 0.4
151 0.49
152 0.55
153 0.58
154 0.63
155 0.68
156 0.72
157 0.72
158 0.73
159 0.72
160 0.75
161 0.8
162 0.81
163 0.77
164 0.75
165 0.69
166 0.65
167 0.62
168 0.6
169 0.55
170 0.52
171 0.53
172 0.48
173 0.45
174 0.41