Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FV04

Protein Details
Accession A0A2I1FV04    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-31CESALQVNKKNRKRKSGEAFGEHydrophilic
NLS Segment(s)
PositionSequence
21-23RKR
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MGFAQNLVQCESALQVNKKNRKRKSGEAFGEDFDYIYGIVTTGAEWYFILFASNRSISSTSKNSLNIRFSESALKEGSEDEKDLYKNVKRVMEVIVGLLKDKLECVGEEPDRKRVRVEGFRSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.37
4 0.48
5 0.56
6 0.65
7 0.68
8 0.73
9 0.78
10 0.8
11 0.81
12 0.82
13 0.8
14 0.76
15 0.7
16 0.61
17 0.55
18 0.44
19 0.34
20 0.22
21 0.16
22 0.09
23 0.07
24 0.06
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.04
31 0.05
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.09
40 0.09
41 0.09
42 0.1
43 0.12
44 0.12
45 0.17
46 0.19
47 0.18
48 0.2
49 0.23
50 0.24
51 0.27
52 0.28
53 0.25
54 0.26
55 0.26
56 0.24
57 0.27
58 0.24
59 0.23
60 0.2
61 0.19
62 0.15
63 0.15
64 0.16
65 0.11
66 0.12
67 0.11
68 0.13
69 0.13
70 0.15
71 0.19
72 0.2
73 0.24
74 0.27
75 0.29
76 0.27
77 0.28
78 0.3
79 0.27
80 0.24
81 0.21
82 0.19
83 0.16
84 0.16
85 0.15
86 0.12
87 0.09
88 0.09
89 0.09
90 0.08
91 0.08
92 0.11
93 0.18
94 0.23
95 0.31
96 0.34
97 0.42
98 0.45
99 0.46
100 0.45
101 0.44
102 0.49
103 0.51
104 0.57