Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H808

Protein Details
Accession A0A2I1H808    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-61KDNSGQTKKNSSSRRRKSQKNSDTQNYPNHydrophilic
NLS Segment(s)
PositionSequence
40-49KKNSSSRRRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.833
Family & Domain DBs
Amino Acid Sequences MKLEKEVRIITEKFKDLEKKKEQGMSSFHKKVKDNSGQTKKNSSSRRRKSQKNSDTQNYPNGKITELSDCYNNCDEMDGKYNSNKSCDMTFYDFPWYFVLDEEIFECIRDVVYVEKITGRSNRSKEILNDKIDDLFLVTELRKLMAMNQQVVLKEIKDGDNINENKKRVAQIQGSRGDDDNEGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.47
4 0.56
5 0.58
6 0.57
7 0.59
8 0.65
9 0.6
10 0.56
11 0.57
12 0.56
13 0.57
14 0.59
15 0.57
16 0.56
17 0.58
18 0.58
19 0.61
20 0.62
21 0.61
22 0.64
23 0.71
24 0.72
25 0.72
26 0.75
27 0.7
28 0.69
29 0.69
30 0.69
31 0.7
32 0.74
33 0.81
34 0.82
35 0.87
36 0.89
37 0.91
38 0.9
39 0.89
40 0.88
41 0.84
42 0.81
43 0.73
44 0.72
45 0.64
46 0.56
47 0.5
48 0.42
49 0.35
50 0.3
51 0.28
52 0.24
53 0.23
54 0.22
55 0.2
56 0.19
57 0.23
58 0.23
59 0.21
60 0.16
61 0.15
62 0.14
63 0.13
64 0.18
65 0.16
66 0.15
67 0.18
68 0.22
69 0.21
70 0.23
71 0.22
72 0.18
73 0.17
74 0.18
75 0.19
76 0.2
77 0.21
78 0.19
79 0.24
80 0.23
81 0.23
82 0.22
83 0.19
84 0.14
85 0.13
86 0.14
87 0.08
88 0.08
89 0.08
90 0.09
91 0.08
92 0.08
93 0.08
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.08
100 0.08
101 0.08
102 0.1
103 0.11
104 0.14
105 0.17
106 0.2
107 0.26
108 0.28
109 0.32
110 0.33
111 0.35
112 0.37
113 0.43
114 0.45
115 0.41
116 0.4
117 0.36
118 0.35
119 0.32
120 0.27
121 0.18
122 0.11
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.09
131 0.12
132 0.17
133 0.21
134 0.21
135 0.23
136 0.25
137 0.25
138 0.26
139 0.24
140 0.17
141 0.16
142 0.16
143 0.15
144 0.16
145 0.17
146 0.18
147 0.27
148 0.29
149 0.36
150 0.4
151 0.4
152 0.4
153 0.43
154 0.44
155 0.39
156 0.44
157 0.45
158 0.47
159 0.55
160 0.6
161 0.59
162 0.57
163 0.54
164 0.47
165 0.39