Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G8C1

Protein Details
Accession A0A2I1G8C1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
66-85INERLKKRSHSRSQRTLDKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 16, cyto 9
Family & Domain DBs
Amino Acid Sequences MSNMGDLGRINVNNAEDFLAFISHNEAIYSQEVTTLLGSFVENGFLKNLFDKAIFAIPVFHIYHFINERLKKRSHSRSQRTLDKLVNELTKSAGFNDELTFDSAFRLFKLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.12
4 0.13
5 0.12
6 0.1
7 0.09
8 0.08
9 0.11
10 0.1
11 0.1
12 0.09
13 0.09
14 0.1
15 0.11
16 0.12
17 0.09
18 0.09
19 0.1
20 0.1
21 0.1
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.08
29 0.07
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.07
43 0.08
44 0.07
45 0.1
46 0.1
47 0.09
48 0.1
49 0.1
50 0.13
51 0.14
52 0.16
53 0.19
54 0.24
55 0.28
56 0.31
57 0.34
58 0.37
59 0.45
60 0.53
61 0.58
62 0.64
63 0.69
64 0.74
65 0.8
66 0.83
67 0.79
68 0.75
69 0.68
70 0.59
71 0.53
72 0.47
73 0.43
74 0.34
75 0.29
76 0.25
77 0.23
78 0.21
79 0.19
80 0.17
81 0.14
82 0.15
83 0.15
84 0.14
85 0.14
86 0.16
87 0.15
88 0.13
89 0.14
90 0.14
91 0.14