Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GEY2

Protein Details
Accession A0A2I1GEY2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-33NKLITYGMKRWKNRHNRFVKISKLVHydrophilic
NLS Segment(s)
PositionSequence
109-123RKKSYLRKLKGLKVR
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
Amino Acid Sequences MLLFDETSNKLITYGMKRWKNRHNRFVKISKLVPKYTPKQIASHWKNYLDPSLCLDSLEFEEKKFIIKWIREHRTVTGVIHWKYVIKDLKIQFGKQHSENKIKNYWNSRKKSYLRKLKGLKVRSIKTKEQVKEQEMTGPEKQEQEQVKILDSKEDERKFIFHHVNSDELLIPKNQNGYSKISISFLLNYDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.39
3 0.47
4 0.53
5 0.62
6 0.71
7 0.76
8 0.79
9 0.82
10 0.82
11 0.82
12 0.85
13 0.85
14 0.82
15 0.78
16 0.75
17 0.73
18 0.7
19 0.64
20 0.61
21 0.61
22 0.59
23 0.61
24 0.63
25 0.56
26 0.53
27 0.56
28 0.61
29 0.59
30 0.62
31 0.57
32 0.51
33 0.51
34 0.49
35 0.49
36 0.4
37 0.34
38 0.3
39 0.29
40 0.26
41 0.24
42 0.22
43 0.17
44 0.17
45 0.21
46 0.17
47 0.13
48 0.15
49 0.15
50 0.17
51 0.16
52 0.18
53 0.19
54 0.23
55 0.31
56 0.4
57 0.46
58 0.47
59 0.49
60 0.46
61 0.43
62 0.41
63 0.33
64 0.28
65 0.29
66 0.26
67 0.25
68 0.24
69 0.21
70 0.21
71 0.27
72 0.24
73 0.18
74 0.24
75 0.24
76 0.33
77 0.33
78 0.33
79 0.3
80 0.3
81 0.33
82 0.3
83 0.37
84 0.33
85 0.41
86 0.43
87 0.44
88 0.46
89 0.45
90 0.47
91 0.49
92 0.54
93 0.55
94 0.58
95 0.58
96 0.61
97 0.64
98 0.7
99 0.71
100 0.72
101 0.68
102 0.72
103 0.75
104 0.74
105 0.76
106 0.69
107 0.67
108 0.65
109 0.64
110 0.64
111 0.63
112 0.6
113 0.6
114 0.64
115 0.59
116 0.59
117 0.61
118 0.55
119 0.51
120 0.47
121 0.44
122 0.37
123 0.4
124 0.32
125 0.28
126 0.26
127 0.26
128 0.26
129 0.28
130 0.28
131 0.27
132 0.3
133 0.28
134 0.29
135 0.3
136 0.3
137 0.28
138 0.27
139 0.29
140 0.34
141 0.35
142 0.34
143 0.32
144 0.34
145 0.32
146 0.38
147 0.4
148 0.32
149 0.37
150 0.37
151 0.37
152 0.36
153 0.35
154 0.29
155 0.23
156 0.23
157 0.18
158 0.18
159 0.18
160 0.22
161 0.22
162 0.25
163 0.27
164 0.32
165 0.34
166 0.36
167 0.35
168 0.31
169 0.31
170 0.28
171 0.28