Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HX40

Protein Details
Accession A0A2I1HX40    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-70VDWVIKKKTKEKKKETAAKRHQTVHydrophilic
NLS Segment(s)
PositionSequence
52-65KKKTKEKKKETAAK
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044044  DUF5679  
Pfam View protein in Pfam  
PF18930  DUF5679  
Amino Acid Sequences MTRFYCLKCKKETETASEVQDMTTNGRYRLHGDCVVCGMHKNTFTGVDWVIKKKTKEKKKETAAKRHQTVYNRQCKKLGQKILEADDTCKQCIDKCLKEAKKRKTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.53
4 0.48
5 0.41
6 0.32
7 0.29
8 0.22
9 0.19
10 0.22
11 0.2
12 0.19
13 0.21
14 0.22
15 0.24
16 0.26
17 0.28
18 0.26
19 0.25
20 0.24
21 0.24
22 0.23
23 0.2
24 0.18
25 0.14
26 0.13
27 0.13
28 0.13
29 0.12
30 0.13
31 0.13
32 0.14
33 0.13
34 0.15
35 0.16
36 0.18
37 0.21
38 0.23
39 0.24
40 0.31
41 0.4
42 0.45
43 0.54
44 0.61
45 0.67
46 0.74
47 0.82
48 0.83
49 0.85
50 0.85
51 0.84
52 0.78
53 0.73
54 0.68
55 0.64
56 0.65
57 0.64
58 0.64
59 0.61
60 0.59
61 0.57
62 0.58
63 0.62
64 0.61
65 0.59
66 0.53
67 0.53
68 0.56
69 0.57
70 0.57
71 0.48
72 0.41
73 0.39
74 0.38
75 0.32
76 0.28
77 0.25
78 0.22
79 0.3
80 0.36
81 0.35
82 0.39
83 0.5
84 0.58
85 0.68
86 0.76