Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GWW8

Protein Details
Accession A0A2I1GWW8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-53ADYKRQNDKSWKKVEHKPIKVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 10.5, mito 5
Family & Domain DBs
Amino Acid Sequences MMMIIIHIFHYFLNGYHLIDLKVYSATWIDGKADYKRQNDKSWKKVEHKPIKVALKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.14
5 0.12
6 0.12
7 0.12
8 0.09
9 0.08
10 0.08
11 0.07
12 0.06
13 0.07
14 0.07
15 0.07
16 0.07
17 0.08
18 0.1
19 0.12
20 0.19
21 0.25
22 0.3
23 0.39
24 0.43
25 0.51
26 0.6
27 0.66
28 0.69
29 0.73
30 0.75
31 0.74
32 0.78
33 0.81
34 0.81
35 0.79
36 0.77
37 0.76
38 0.78