Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GNT4

Protein Details
Accession A0A2I1GNT4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
180-200NEDALDKKKKNNNDENNNPDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013784  Carb-bd-like_fold  
IPR013783  Ig-like_fold  
Gene Ontology GO:0030246  F:carbohydrate binding  
Amino Acid Sequences MSSETNRDGTVILPDKSTVETFSETSVQADDSEHQNGADDSTGTNQNHDPQQSQPESTNTENKNFFKGWKKTIFGDDSSNIKVTFHVYLPSFEFFEGYPIVVGNIEELGNWENPIVKLKQQKGEYLHSKSNYWYSDPISIPLERFNNYEVKYKYAFFIPKPKIEEKSKFSLFTKSKSDKNEDALDKKKKNNNDENNNPDDSSVTQES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.25
4 0.25
5 0.18
6 0.16
7 0.18
8 0.17
9 0.19
10 0.2
11 0.18
12 0.18
13 0.17
14 0.15
15 0.12
16 0.13
17 0.13
18 0.14
19 0.16
20 0.15
21 0.15
22 0.15
23 0.15
24 0.14
25 0.13
26 0.09
27 0.08
28 0.11
29 0.17
30 0.16
31 0.18
32 0.19
33 0.22
34 0.26
35 0.27
36 0.26
37 0.23
38 0.31
39 0.31
40 0.32
41 0.3
42 0.29
43 0.32
44 0.33
45 0.38
46 0.32
47 0.36
48 0.39
49 0.38
50 0.39
51 0.35
52 0.37
53 0.39
54 0.42
55 0.44
56 0.44
57 0.46
58 0.44
59 0.48
60 0.46
61 0.38
62 0.36
63 0.31
64 0.28
65 0.27
66 0.26
67 0.2
68 0.17
69 0.16
70 0.14
71 0.13
72 0.1
73 0.12
74 0.11
75 0.13
76 0.14
77 0.15
78 0.13
79 0.12
80 0.12
81 0.09
82 0.1
83 0.09
84 0.07
85 0.06
86 0.05
87 0.06
88 0.05
89 0.05
90 0.03
91 0.04
92 0.04
93 0.03
94 0.04
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.1
102 0.1
103 0.13
104 0.2
105 0.24
106 0.31
107 0.31
108 0.36
109 0.37
110 0.44
111 0.47
112 0.45
113 0.46
114 0.41
115 0.4
116 0.37
117 0.38
118 0.32
119 0.27
120 0.24
121 0.21
122 0.25
123 0.24
124 0.25
125 0.22
126 0.21
127 0.2
128 0.22
129 0.22
130 0.18
131 0.19
132 0.19
133 0.22
134 0.24
135 0.31
136 0.28
137 0.3
138 0.31
139 0.3
140 0.3
141 0.29
142 0.31
143 0.26
144 0.35
145 0.36
146 0.4
147 0.45
148 0.49
149 0.5
150 0.55
151 0.6
152 0.55
153 0.59
154 0.57
155 0.54
156 0.51
157 0.55
158 0.49
159 0.47
160 0.51
161 0.48
162 0.5
163 0.53
164 0.59
165 0.53
166 0.56
167 0.59
168 0.56
169 0.59
170 0.63
171 0.66
172 0.65
173 0.7
174 0.71
175 0.71
176 0.74
177 0.77
178 0.79
179 0.79
180 0.83
181 0.82
182 0.8
183 0.73
184 0.63
185 0.53
186 0.44
187 0.34