Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G2N5

Protein Details
Accession A0A2I1G2N5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
92-118GNIDERKKKNLRKKIHQTNKKRLFIKRBasic
NLS Segment(s)
PositionSequence
97-114RKKKNLRKKIHQTNKKRL
Subcellular Location(s) mito 18.5, mito_nucl 12.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences MSSYITFRTHCSTLFLKSLPNNTNKLIISMSPLSHLIRINSIITNSHIQFSKSLSHNHYTTKSTKYNNDNIHGHILYYLKEDKLSSKDFDWGNIDERKKKNLRKKIHQTNKKRLFIKRNIIQVNFDALEDFTEWLSNLRFKKWAPMFEGMKWQDIIQLNDEQLLEKGIKTFTVRSELLYYFNIIKAAKAEKDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.3
4 0.33
5 0.4
6 0.41
7 0.43
8 0.43
9 0.4
10 0.45
11 0.4
12 0.37
13 0.3
14 0.24
15 0.25
16 0.24
17 0.22
18 0.19
19 0.2
20 0.19
21 0.21
22 0.22
23 0.17
24 0.17
25 0.18
26 0.18
27 0.18
28 0.17
29 0.16
30 0.17
31 0.21
32 0.19
33 0.2
34 0.2
35 0.19
36 0.19
37 0.2
38 0.24
39 0.22
40 0.26
41 0.28
42 0.32
43 0.33
44 0.36
45 0.37
46 0.34
47 0.35
48 0.37
49 0.38
50 0.38
51 0.44
52 0.46
53 0.51
54 0.51
55 0.54
56 0.49
57 0.45
58 0.46
59 0.38
60 0.32
61 0.25
62 0.21
63 0.15
64 0.16
65 0.16
66 0.11
67 0.12
68 0.12
69 0.13
70 0.16
71 0.18
72 0.17
73 0.16
74 0.21
75 0.21
76 0.22
77 0.22
78 0.19
79 0.21
80 0.24
81 0.26
82 0.28
83 0.3
84 0.36
85 0.4
86 0.47
87 0.53
88 0.58
89 0.65
90 0.69
91 0.78
92 0.82
93 0.86
94 0.88
95 0.88
96 0.9
97 0.9
98 0.87
99 0.81
100 0.77
101 0.76
102 0.75
103 0.75
104 0.69
105 0.68
106 0.64
107 0.6
108 0.54
109 0.46
110 0.4
111 0.31
112 0.25
113 0.17
114 0.12
115 0.12
116 0.11
117 0.1
118 0.06
119 0.06
120 0.06
121 0.07
122 0.09
123 0.13
124 0.14
125 0.15
126 0.18
127 0.18
128 0.28
129 0.32
130 0.36
131 0.35
132 0.42
133 0.43
134 0.42
135 0.52
136 0.43
137 0.4
138 0.36
139 0.31
140 0.29
141 0.29
142 0.29
143 0.23
144 0.23
145 0.21
146 0.23
147 0.23
148 0.17
149 0.14
150 0.14
151 0.12
152 0.1
153 0.12
154 0.1
155 0.12
156 0.14
157 0.17
158 0.18
159 0.24
160 0.24
161 0.25
162 0.29
163 0.28
164 0.28
165 0.27
166 0.27
167 0.22
168 0.23
169 0.23
170 0.18
171 0.18
172 0.19
173 0.23