Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AT95

Protein Details
Accession G3AT95   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-41NESTAPVKKKYTRRRLLPRSKNGCWIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
KEGG spaa:SPAPADRAFT_62756  -  
Amino Acid Sequences MSPSDDSSYDRSLDSNESTAPVKKKYTRRRLLPRSKNGCWILCASCFKFGIECDYNPVKPDYVTDKNLRKQKLIDITTTRKKQASICGGTKSKKSKSAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.16
4 0.17
5 0.19
6 0.24
7 0.25
8 0.25
9 0.3
10 0.36
11 0.46
12 0.55
13 0.64
14 0.68
15 0.75
16 0.83
17 0.88
18 0.91
19 0.91
20 0.91
21 0.88
22 0.81
23 0.79
24 0.71
25 0.61
26 0.51
27 0.44
28 0.35
29 0.29
30 0.31
31 0.23
32 0.22
33 0.21
34 0.19
35 0.17
36 0.15
37 0.18
38 0.17
39 0.16
40 0.19
41 0.21
42 0.21
43 0.21
44 0.22
45 0.16
46 0.14
47 0.17
48 0.19
49 0.22
50 0.26
51 0.32
52 0.39
53 0.45
54 0.52
55 0.52
56 0.47
57 0.44
58 0.47
59 0.5
60 0.45
61 0.44
62 0.45
63 0.52
64 0.59
65 0.61
66 0.57
67 0.49
68 0.49
69 0.46
70 0.49
71 0.49
72 0.47
73 0.47
74 0.52
75 0.57
76 0.59
77 0.63
78 0.62
79 0.59