Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PF67

Protein Details
Accession J3PF67   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
122-145AVWATTLSKRPRPRRALRSGVPGHHydrophilic
NLS Segment(s)
PositionSequence
130-148KRPRPRRALRSGVPGHGHK
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006760  Endosulphine  
Pfam View protein in Pfam  
PF04667  Endosulfine  
Amino Acid Sequences MGLNSRSPVPRRTKISFRKYFDSGDFALSKTKTPSDAGAVITGSEHPTRETVTHPSSPVPSSSNVGDNAGEQLVQCGSLWLRSRLNNYVPVVTSRYGPVWARGRYYVGNAQAKQHKGHQGNAVWATTLSKRPRPRRALRSGVPGHGHKSVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.8
4 0.77
5 0.75
6 0.71
7 0.68
8 0.59
9 0.54
10 0.44
11 0.39
12 0.33
13 0.27
14 0.29
15 0.25
16 0.24
17 0.22
18 0.22
19 0.19
20 0.2
21 0.21
22 0.2
23 0.21
24 0.2
25 0.18
26 0.17
27 0.15
28 0.14
29 0.13
30 0.11
31 0.1
32 0.09
33 0.09
34 0.1
35 0.11
36 0.12
37 0.14
38 0.17
39 0.21
40 0.23
41 0.23
42 0.24
43 0.25
44 0.24
45 0.23
46 0.19
47 0.16
48 0.15
49 0.16
50 0.16
51 0.15
52 0.15
53 0.13
54 0.12
55 0.11
56 0.09
57 0.08
58 0.06
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.08
66 0.09
67 0.12
68 0.14
69 0.16
70 0.19
71 0.23
72 0.25
73 0.26
74 0.26
75 0.25
76 0.23
77 0.23
78 0.22
79 0.19
80 0.18
81 0.13
82 0.13
83 0.14
84 0.14
85 0.19
86 0.23
87 0.24
88 0.26
89 0.26
90 0.28
91 0.26
92 0.3
93 0.28
94 0.28
95 0.33
96 0.32
97 0.37
98 0.41
99 0.43
100 0.41
101 0.42
102 0.44
103 0.4
104 0.44
105 0.45
106 0.41
107 0.45
108 0.45
109 0.39
110 0.3
111 0.28
112 0.26
113 0.21
114 0.27
115 0.27
116 0.33
117 0.43
118 0.52
119 0.63
120 0.71
121 0.78
122 0.81
123 0.85
124 0.87
125 0.83
126 0.83
127 0.78
128 0.74
129 0.69
130 0.62
131 0.56
132 0.51