Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G8H9

Protein Details
Accession A0A2I1G8H9   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-145FNKRNLYYNKGKPSYKKREKYCKKKLSLSDFIKCSLSKAEKAKKKAREEKAKEDRKKKLKKEREEKAKKEREEKAKKEREEKAKKAREEKAKKDREEKAKKAREEKAKKDREKNKNKNKDKVGDDBasic
NLS Segment(s)
PositionSequence
58-140KAEKAKKKAREEKAKEDRKKKLKKEREEKAKKEREEKAKKEREEKAKKAREEKAKKDREEKAKKAREEKAKKDREKNKNKNKD
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027512  EIF3A  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0016020  C:membrane  
GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MGIHSQNDEIPVEIINRNLLFNKRNLYYNKGKPSYKKREKYCKKKLSLSDFIKCSLSKAEKAKKKAREEKAKEDRKKKLKKEREEKAKKEREEKAKKEREEKAKKAREEKAKKDREEKAKKAREEKAKKDREKNKNKNKDKVGDDDNNNDNNNNDNNNNNNNNNDNNDNNDGNNGNNGNNGNDGNVPPPNQTGAPELTNTPTNPNQMTPAATFAPTNTYMSNASSLPSEDGRQKLSIAGISVISMILVGVIVLIILAVYRRRNSMRRGAVRLYDEPGQNDSSVIPRYLSMRSLRIPSMPPKVQLTRLSSATILLPYRENNPSPLNNNTNNPAPSFNNLNNNYLSPYTKVHNLSSPNSSSSGSLSVNVNNNLEQNSQKTDSVQSYSSLESSFPIPPQRAVNDNYNTTPTSATFGDMYKLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.19
5 0.23
6 0.28
7 0.28
8 0.32
9 0.38
10 0.36
11 0.43
12 0.45
13 0.49
14 0.53
15 0.59
16 0.65
17 0.66
18 0.69
19 0.72
20 0.79
21 0.83
22 0.83
23 0.84
24 0.84
25 0.88
26 0.92
27 0.94
28 0.94
29 0.93
30 0.91
31 0.91
32 0.9
33 0.88
34 0.87
35 0.83
36 0.81
37 0.72
38 0.65
39 0.59
40 0.49
41 0.42
42 0.39
43 0.36
44 0.35
45 0.42
46 0.51
47 0.56
48 0.65
49 0.72
50 0.73
51 0.79
52 0.83
53 0.84
54 0.85
55 0.85
56 0.87
57 0.89
58 0.9
59 0.89
60 0.88
61 0.88
62 0.87
63 0.9
64 0.89
65 0.89
66 0.89
67 0.91
68 0.92
69 0.92
70 0.93
71 0.93
72 0.92
73 0.91
74 0.9
75 0.86
76 0.84
77 0.83
78 0.82
79 0.82
80 0.82
81 0.82
82 0.82
83 0.82
84 0.82
85 0.82
86 0.82
87 0.82
88 0.82
89 0.82
90 0.81
91 0.82
92 0.82
93 0.81
94 0.81
95 0.8
96 0.81
97 0.81
98 0.81
99 0.8
100 0.8
101 0.81
102 0.81
103 0.81
104 0.8
105 0.8
106 0.8
107 0.81
108 0.8
109 0.8
110 0.8
111 0.79
112 0.81
113 0.8
114 0.82
115 0.84
116 0.86
117 0.88
118 0.88
119 0.89
120 0.9
121 0.9
122 0.91
123 0.91
124 0.9
125 0.88
126 0.85
127 0.77
128 0.73
129 0.7
130 0.66
131 0.6
132 0.57
133 0.53
134 0.48
135 0.44
136 0.37
137 0.3
138 0.25
139 0.24
140 0.21
141 0.17
142 0.17
143 0.21
144 0.28
145 0.31
146 0.29
147 0.3
148 0.3
149 0.3
150 0.3
151 0.28
152 0.23
153 0.22
154 0.25
155 0.23
156 0.2
157 0.2
158 0.18
159 0.15
160 0.17
161 0.14
162 0.1
163 0.12
164 0.12
165 0.11
166 0.12
167 0.11
168 0.1
169 0.1
170 0.1
171 0.1
172 0.11
173 0.11
174 0.11
175 0.11
176 0.11
177 0.11
178 0.11
179 0.12
180 0.13
181 0.12
182 0.13
183 0.13
184 0.13
185 0.15
186 0.14
187 0.15
188 0.15
189 0.16
190 0.16
191 0.16
192 0.17
193 0.16
194 0.17
195 0.13
196 0.14
197 0.12
198 0.12
199 0.11
200 0.09
201 0.12
202 0.11
203 0.12
204 0.09
205 0.1
206 0.1
207 0.11
208 0.12
209 0.09
210 0.09
211 0.08
212 0.09
213 0.09
214 0.09
215 0.1
216 0.12
217 0.13
218 0.14
219 0.14
220 0.14
221 0.14
222 0.14
223 0.13
224 0.1
225 0.09
226 0.07
227 0.07
228 0.07
229 0.06
230 0.05
231 0.04
232 0.03
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.01
239 0.01
240 0.01
241 0.01
242 0.01
243 0.02
244 0.05
245 0.07
246 0.08
247 0.11
248 0.16
249 0.21
250 0.26
251 0.36
252 0.43
253 0.48
254 0.53
255 0.53
256 0.53
257 0.53
258 0.49
259 0.43
260 0.37
261 0.32
262 0.28
263 0.27
264 0.24
265 0.19
266 0.18
267 0.15
268 0.14
269 0.14
270 0.13
271 0.11
272 0.11
273 0.13
274 0.14
275 0.17
276 0.17
277 0.19
278 0.21
279 0.24
280 0.25
281 0.25
282 0.28
283 0.31
284 0.37
285 0.35
286 0.35
287 0.38
288 0.4
289 0.43
290 0.45
291 0.44
292 0.4
293 0.39
294 0.37
295 0.32
296 0.3
297 0.25
298 0.22
299 0.16
300 0.13
301 0.14
302 0.14
303 0.18
304 0.22
305 0.22
306 0.23
307 0.28
308 0.31
309 0.33
310 0.39
311 0.41
312 0.41
313 0.43
314 0.43
315 0.43
316 0.4
317 0.38
318 0.34
319 0.29
320 0.29
321 0.32
322 0.32
323 0.36
324 0.37
325 0.39
326 0.36
327 0.35
328 0.34
329 0.3
330 0.28
331 0.21
332 0.21
333 0.21
334 0.26
335 0.28
336 0.28
337 0.32
338 0.35
339 0.37
340 0.4
341 0.4
342 0.36
343 0.34
344 0.33
345 0.27
346 0.24
347 0.24
348 0.18
349 0.18
350 0.18
351 0.21
352 0.25
353 0.27
354 0.27
355 0.24
356 0.25
357 0.25
358 0.26
359 0.24
360 0.22
361 0.26
362 0.27
363 0.27
364 0.27
365 0.3
366 0.31
367 0.32
368 0.3
369 0.26
370 0.25
371 0.26
372 0.25
373 0.21
374 0.17
375 0.15
376 0.17
377 0.18
378 0.19
379 0.24
380 0.25
381 0.27
382 0.32
383 0.35
384 0.37
385 0.39
386 0.45
387 0.45
388 0.47
389 0.47
390 0.45
391 0.42
392 0.38
393 0.35
394 0.26
395 0.24
396 0.2
397 0.19
398 0.18
399 0.18
400 0.21