Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GQF0

Protein Details
Accession A0A2I1GQF0   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-52NTQIQTTEPPNKRKKRIQPVEQTTQVQHydrophilic
143-169VKGGKREEPRPLRRNSHKQLEQKQTVGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGRRSKNNNKNNQPHTQASVSTYQPNTQIQTTEPPNKRKKRIQPVEQTTQVQVPRQSVFDRLGTKNSGAAPLPRQPTIKKEVKEHLSGIETRKSRRISDARKAEREQLEGEPNQESTQDDKNKSEGGTKRNTAISKINPNNTVKGGKREEPRPLRRNSHKQLEQKQTVGEDDFQESEIPSTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.7
3 0.62
4 0.52
5 0.45
6 0.43
7 0.37
8 0.36
9 0.33
10 0.3
11 0.3
12 0.31
13 0.31
14 0.27
15 0.26
16 0.22
17 0.28
18 0.33
19 0.4
20 0.44
21 0.51
22 0.6
23 0.69
24 0.75
25 0.78
26 0.82
27 0.83
28 0.86
29 0.87
30 0.88
31 0.87
32 0.86
33 0.81
34 0.72
35 0.62
36 0.56
37 0.47
38 0.39
39 0.33
40 0.27
41 0.23
42 0.23
43 0.23
44 0.21
45 0.22
46 0.22
47 0.26
48 0.24
49 0.26
50 0.26
51 0.25
52 0.25
53 0.23
54 0.2
55 0.16
56 0.16
57 0.17
58 0.21
59 0.23
60 0.23
61 0.24
62 0.24
63 0.28
64 0.34
65 0.37
66 0.33
67 0.36
68 0.41
69 0.43
70 0.44
71 0.4
72 0.34
73 0.29
74 0.29
75 0.26
76 0.25
77 0.23
78 0.22
79 0.27
80 0.28
81 0.26
82 0.32
83 0.39
84 0.4
85 0.48
86 0.57
87 0.58
88 0.62
89 0.62
90 0.61
91 0.54
92 0.49
93 0.42
94 0.34
95 0.32
96 0.27
97 0.26
98 0.2
99 0.19
100 0.17
101 0.15
102 0.13
103 0.12
104 0.19
105 0.24
106 0.25
107 0.26
108 0.28
109 0.29
110 0.29
111 0.33
112 0.31
113 0.3
114 0.35
115 0.35
116 0.37
117 0.4
118 0.4
119 0.36
120 0.37
121 0.38
122 0.42
123 0.47
124 0.49
125 0.5
126 0.51
127 0.51
128 0.47
129 0.47
130 0.39
131 0.42
132 0.42
133 0.44
134 0.49
135 0.52
136 0.59
137 0.63
138 0.7
139 0.7
140 0.73
141 0.76
142 0.8
143 0.85
144 0.83
145 0.84
146 0.82
147 0.84
148 0.86
149 0.86
150 0.81
151 0.72
152 0.66
153 0.57
154 0.51
155 0.44
156 0.36
157 0.27
158 0.25
159 0.23
160 0.21
161 0.2
162 0.18
163 0.16