Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G2U0

Protein Details
Accession A0A2I1G2U0   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
107-164RFEAVVKKSEKKKQGKREREEGEKKKERETKKKMKREKTKEKEREKGANKKKIKLKKABasic
NLS Segment(s)
PositionSequence
113-164KKSEKKKQGKREREEGEKKKERETKKKMKREKTKEKEREKGANKKKIKLKKA
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MPISGTPVGYVDIYRKCWQNNPDDRPVMQQVLSNLRSINLNTAEESEECDKINEMQIDEELTATNVNNEIIVNELYDIIENFTETREITTLVLLACDFHVTIWLNGRFEAVVKKSEKKKQGKREREEGEKKKERETKKKMKREKTKEKEREKGANKKKIKLKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.33
4 0.4
5 0.46
6 0.51
7 0.57
8 0.59
9 0.64
10 0.63
11 0.61
12 0.59
13 0.57
14 0.48
15 0.38
16 0.33
17 0.28
18 0.32
19 0.32
20 0.27
21 0.23
22 0.21
23 0.22
24 0.21
25 0.22
26 0.16
27 0.16
28 0.16
29 0.17
30 0.18
31 0.17
32 0.2
33 0.17
34 0.15
35 0.15
36 0.15
37 0.14
38 0.13
39 0.17
40 0.15
41 0.13
42 0.13
43 0.12
44 0.13
45 0.12
46 0.11
47 0.07
48 0.06
49 0.06
50 0.05
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.07
78 0.06
79 0.06
80 0.05
81 0.05
82 0.04
83 0.05
84 0.05
85 0.04
86 0.06
87 0.07
88 0.08
89 0.14
90 0.16
91 0.16
92 0.16
93 0.16
94 0.14
95 0.14
96 0.18
97 0.13
98 0.17
99 0.2
100 0.28
101 0.35
102 0.43
103 0.52
104 0.58
105 0.67
106 0.72
107 0.81
108 0.84
109 0.84
110 0.86
111 0.84
112 0.84
113 0.85
114 0.83
115 0.82
116 0.81
117 0.76
118 0.75
119 0.76
120 0.75
121 0.76
122 0.78
123 0.78
124 0.79
125 0.88
126 0.89
127 0.92
128 0.93
129 0.93
130 0.94
131 0.93
132 0.94
133 0.94
134 0.94
135 0.92
136 0.89
137 0.89
138 0.87
139 0.87
140 0.86
141 0.86
142 0.82
143 0.82
144 0.84