Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P9J6

Protein Details
Accession J3P9J6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
90-116EKMAEKMHKKRVERLKRREKRNKVLNSBasic
NLS Segment(s)
PositionSequence
13-112PKSLGMRKNGKQWHAPRKAFRPGSGLTSYEKRAKDRVTMAAVKAKEKEMKDEKEAERQQRVQAIKDRKAAKEEKERYEKMAEKMHKKRVERLKRREKRNK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSAEATMTKPPPKSLGMRKNGKQWHAPRKAFRPGSGLTSYEKRAKDRVTMAAVKAKEKEMKDEKEAERQQRVQAIKDRKAAKEEKERYEKMAEKMHKKRVERLKRREKRNKVLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.51
4 0.56
5 0.64
6 0.66
7 0.72
8 0.74
9 0.7
10 0.69
11 0.68
12 0.7
13 0.71
14 0.73
15 0.71
16 0.72
17 0.77
18 0.7
19 0.62
20 0.56
21 0.47
22 0.46
23 0.4
24 0.34
25 0.27
26 0.28
27 0.29
28 0.3
29 0.3
30 0.27
31 0.3
32 0.3
33 0.32
34 0.31
35 0.32
36 0.31
37 0.32
38 0.3
39 0.31
40 0.3
41 0.27
42 0.25
43 0.23
44 0.22
45 0.21
46 0.27
47 0.29
48 0.32
49 0.33
50 0.39
51 0.39
52 0.44
53 0.49
54 0.46
55 0.45
56 0.44
57 0.43
58 0.42
59 0.42
60 0.36
61 0.4
62 0.43
63 0.43
64 0.48
65 0.5
66 0.46
67 0.51
68 0.52
69 0.51
70 0.54
71 0.55
72 0.57
73 0.62
74 0.61
75 0.59
76 0.61
77 0.59
78 0.52
79 0.54
80 0.53
81 0.55
82 0.63
83 0.69
84 0.69
85 0.67
86 0.72
87 0.74
88 0.77
89 0.78
90 0.8
91 0.82
92 0.84
93 0.92
94 0.94
95 0.93
96 0.93