Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H6U4

Protein Details
Accession A0A2I1H6U4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLKKTKVHRKKKTVKSRLPLTKLAKBasic
NLS Segment(s)
PositionSequence
3-20KKTKVHRKKKTVKSRLPL
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLKKTKVHRKKKTVKSRLPLTKLAKTVKSKLLIFHIRIFLLGIIYSHYFTYLTSFQSIALIVRRTIIKNVLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.91
4 0.9
5 0.84
6 0.82
7 0.77
8 0.72
9 0.68
10 0.63
11 0.59
12 0.54
13 0.53
14 0.5
15 0.48
16 0.42
17 0.38
18 0.41
19 0.39
20 0.37
21 0.35
22 0.3
23 0.26
24 0.25
25 0.23
26 0.15
27 0.11
28 0.08
29 0.05
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.11
38 0.11
39 0.12
40 0.13
41 0.13
42 0.13
43 0.13
44 0.14
45 0.11
46 0.14
47 0.14
48 0.13
49 0.16
50 0.19
51 0.2
52 0.24