Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G912

Protein Details
Accession A0A2I1G912    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-28ALKLRFILTKKTRKIKIKPPLFAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, extr 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MLVAIALKLRFILTKKTRKIKIKPPLFATSDATVDVIVDTFGAAAVVAPVPPSIGAVPGTVPPSFSAVVPEAGATPSFFGAVSPSLGAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.5
3 0.6
4 0.68
5 0.74
6 0.81
7 0.81
8 0.82
9 0.82
10 0.79
11 0.76
12 0.73
13 0.66
14 0.6
15 0.53
16 0.44
17 0.35
18 0.28
19 0.22
20 0.15
21 0.13
22 0.1
23 0.06
24 0.04
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.08
46 0.1
47 0.09
48 0.1
49 0.09
50 0.11
51 0.12
52 0.11
53 0.12
54 0.12
55 0.13
56 0.12
57 0.12
58 0.1
59 0.1
60 0.11
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.08
68 0.09
69 0.1