Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HAK3

Protein Details
Accession A0A2I1HAK3    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-34ILWAVPKKKTSHSKKRMRSANKGLKDKHydrophilic
NLS Segment(s)
PositionSequence
14-30KKKTSHSKKRMRSANKG
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LAEILGPILWAVPKKKTSHSKKRMRSANKGLKDKTNIVNCPGCGQKHLTHHLCFNCYKNFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.35
3 0.45
4 0.55
5 0.63
6 0.71
7 0.76
8 0.8
9 0.87
10 0.88
11 0.85
12 0.84
13 0.84
14 0.83
15 0.8
16 0.78
17 0.7
18 0.65
19 0.61
20 0.55
21 0.51
22 0.48
23 0.41
24 0.38
25 0.39
26 0.35
27 0.34
28 0.34
29 0.27
30 0.23
31 0.26
32 0.27
33 0.31
34 0.4
35 0.42
36 0.41
37 0.48
38 0.49
39 0.49
40 0.48
41 0.46