Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NWL7

Protein Details
Accession J3NWL7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MMVPFDSKRRQRRLAPRPSPALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MMVPFDSKRRQRRLAPRPSPALIRALLWATPLAEDARAYGGRYCGPHLQPKTLEYMVGAIVGHTFSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.81
4 0.78
5 0.73
6 0.66
7 0.56
8 0.49
9 0.38
10 0.3
11 0.23
12 0.18
13 0.15
14 0.13
15 0.11
16 0.08
17 0.07
18 0.08
19 0.06
20 0.06
21 0.06
22 0.05
23 0.07
24 0.07
25 0.08
26 0.08
27 0.09
28 0.11
29 0.12
30 0.14
31 0.17
32 0.2
33 0.28
34 0.3
35 0.34
36 0.34
37 0.34
38 0.37
39 0.32
40 0.3
41 0.21
42 0.2
43 0.15
44 0.14
45 0.13
46 0.07
47 0.07
48 0.07
49 0.08