Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HLI6

Protein Details
Accession A0A2I1HLI6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
144-184LIKKHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKBasic
NLS Segment(s)
PositionSequence
147-197KHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKERENEKEKEKEKE
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAAEDTVEILTEKLKIYQKLMESFAPSIPVPLNILTPQGSSTPSTQGSSTPASIPFPTAVAKIIYKPTKRYIKVEEILALTDLKKNEYNNLLSEVRFVMASLHTDFNIPYKSQNINLISKIIKKFTKRNPNAPFGEGNWVVKELIKKHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKERENEKEKEKEKENRNEIERENENIKCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.26
4 0.31
5 0.35
6 0.38
7 0.41
8 0.37
9 0.35
10 0.34
11 0.32
12 0.29
13 0.24
14 0.21
15 0.18
16 0.17
17 0.15
18 0.14
19 0.15
20 0.13
21 0.15
22 0.13
23 0.13
24 0.13
25 0.13
26 0.14
27 0.14
28 0.15
29 0.17
30 0.18
31 0.19
32 0.18
33 0.18
34 0.2
35 0.21
36 0.2
37 0.18
38 0.17
39 0.18
40 0.18
41 0.18
42 0.15
43 0.13
44 0.13
45 0.12
46 0.12
47 0.12
48 0.12
49 0.13
50 0.2
51 0.26
52 0.28
53 0.31
54 0.39
55 0.46
56 0.49
57 0.52
58 0.51
59 0.53
60 0.53
61 0.5
62 0.44
63 0.35
64 0.32
65 0.28
66 0.21
67 0.13
68 0.13
69 0.12
70 0.12
71 0.13
72 0.13
73 0.16
74 0.19
75 0.2
76 0.18
77 0.23
78 0.22
79 0.19
80 0.2
81 0.17
82 0.13
83 0.12
84 0.11
85 0.07
86 0.06
87 0.08
88 0.08
89 0.09
90 0.08
91 0.09
92 0.09
93 0.1
94 0.11
95 0.1
96 0.09
97 0.12
98 0.13
99 0.14
100 0.19
101 0.21
102 0.21
103 0.21
104 0.23
105 0.21
106 0.25
107 0.25
108 0.23
109 0.24
110 0.27
111 0.35
112 0.43
113 0.53
114 0.54
115 0.62
116 0.64
117 0.68
118 0.66
119 0.6
120 0.52
121 0.42
122 0.43
123 0.34
124 0.28
125 0.21
126 0.19
127 0.16
128 0.17
129 0.19
130 0.15
131 0.2
132 0.25
133 0.29
134 0.37
135 0.46
136 0.49
137 0.53
138 0.6
139 0.64
140 0.69
141 0.75
142 0.77
143 0.78
144 0.81
145 0.83
146 0.83
147 0.83
148 0.84
149 0.83
150 0.82
151 0.82
152 0.86
153 0.84
154 0.85
155 0.85
156 0.85
157 0.86
158 0.87
159 0.88
160 0.84
161 0.87
162 0.84
163 0.84
164 0.81
165 0.81
166 0.78
167 0.77
168 0.79
169 0.79
170 0.79
171 0.78
172 0.79
173 0.79
174 0.78
175 0.77
176 0.76
177 0.75
178 0.73
179 0.72
180 0.73
181 0.71
182 0.75
183 0.76
184 0.76
185 0.75
186 0.75
187 0.74
188 0.68
189 0.67
190 0.6
191 0.55
192 0.53