Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NPW6

Protein Details
Accession J3NPW6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
36-59DWIGLKIRTKRAKSNKNNRKLENGHydrophilic
NLS Segment(s)
PositionSequence
24-30KRKAKYR
39-53GLKIRTKRAKSNKNN
Subcellular Location(s) mito 13.5, cyto_mito 9, plas 4, cyto 3.5, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVYYFFKLFNFKAKAIQKLTVSLKRKAKYRNLKSTDWIGLKIRTKRAKSNKNNRKLENGYGNVNWGPALIIKITITACKFALYAHKTKLAKKRPVKFFAFNALLNGYTRYFVIGNTHFPINLLILYNASKILRRRAKHLQLFAFAFAKIFVLIKARIMETKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.53
4 0.44
5 0.47
6 0.54
7 0.54
8 0.53
9 0.54
10 0.58
11 0.57
12 0.63
13 0.64
14 0.67
15 0.69
16 0.75
17 0.78
18 0.75
19 0.74
20 0.72
21 0.69
22 0.65
23 0.56
24 0.48
25 0.4
26 0.4
27 0.44
28 0.45
29 0.48
30 0.49
31 0.51
32 0.58
33 0.66
34 0.71
35 0.75
36 0.81
37 0.82
38 0.84
39 0.89
40 0.81
41 0.8
42 0.73
43 0.68
44 0.65
45 0.56
46 0.49
47 0.4
48 0.4
49 0.31
50 0.26
51 0.2
52 0.11
53 0.09
54 0.06
55 0.07
56 0.05
57 0.05
58 0.05
59 0.07
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.15
69 0.17
70 0.2
71 0.21
72 0.27
73 0.28
74 0.35
75 0.44
76 0.46
77 0.52
78 0.58
79 0.66
80 0.68
81 0.73
82 0.73
83 0.67
84 0.6
85 0.58
86 0.52
87 0.43
88 0.35
89 0.29
90 0.24
91 0.2
92 0.19
93 0.12
94 0.09
95 0.09
96 0.09
97 0.09
98 0.08
99 0.13
100 0.13
101 0.16
102 0.18
103 0.19
104 0.17
105 0.17
106 0.18
107 0.13
108 0.12
109 0.1
110 0.08
111 0.09
112 0.1
113 0.1
114 0.11
115 0.1
116 0.14
117 0.16
118 0.26
119 0.34
120 0.35
121 0.42
122 0.51
123 0.62
124 0.66
125 0.71
126 0.65
127 0.63
128 0.63
129 0.58
130 0.49
131 0.38
132 0.3
133 0.22
134 0.18
135 0.12
136 0.11
137 0.09
138 0.12
139 0.12
140 0.15
141 0.18
142 0.19