Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G6C1

Protein Details
Accession A0A2I1G6C1   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-93CSKTTFSRKVSRKNPFTRKKLNKEQLKEFERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSFSQQTYQKIMKKVNRNDEGSNDERNRKRIAVRCQGLCDLEHINYVINSPASFGGEKRARSCSKTTFSRKVSRKNPFTRKKLNKEQLKEFERALEAEATWRLDKEDLAISCTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.74
4 0.72
5 0.68
6 0.64
7 0.63
8 0.56
9 0.55
10 0.49
11 0.5
12 0.5
13 0.5
14 0.49
15 0.45
16 0.49
17 0.49
18 0.54
19 0.55
20 0.57
21 0.56
22 0.56
23 0.55
24 0.48
25 0.4
26 0.32
27 0.23
28 0.18
29 0.16
30 0.13
31 0.11
32 0.1
33 0.1
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.14
43 0.17
44 0.18
45 0.19
46 0.26
47 0.26
48 0.29
49 0.33
50 0.31
51 0.34
52 0.43
53 0.49
54 0.51
55 0.55
56 0.62
57 0.65
58 0.69
59 0.72
60 0.73
61 0.75
62 0.77
63 0.82
64 0.83
65 0.84
66 0.86
67 0.87
68 0.87
69 0.88
70 0.88
71 0.86
72 0.83
73 0.84
74 0.83
75 0.77
76 0.69
77 0.58
78 0.51
79 0.43
80 0.37
81 0.29
82 0.2
83 0.16
84 0.16
85 0.18
86 0.18
87 0.17
88 0.17
89 0.17
90 0.16
91 0.16
92 0.16
93 0.21
94 0.19