Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HK13

Protein Details
Accession A0A2I1HK13    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MLSNWDLKQRKERKRFQAVLKGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLSNWDLKQRKERKRFQAVLKGVPTSVTTAILYSDNPAHSVLVPLGCKAFKIIQDRAWTNLLVIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.84
4 0.84
5 0.78
6 0.75
7 0.67
8 0.57
9 0.46
10 0.39
11 0.31
12 0.22
13 0.18
14 0.12
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.08
21 0.09
22 0.08
23 0.09
24 0.09
25 0.08
26 0.08
27 0.09
28 0.09
29 0.1
30 0.1
31 0.09
32 0.11
33 0.1
34 0.1
35 0.12
36 0.14
37 0.17
38 0.24
39 0.27
40 0.31
41 0.39
42 0.41
43 0.42
44 0.42
45 0.36