Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NN50

Protein Details
Accession J3NN50    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-42TAKPLKKGARVTKPKKAKPTKADKLVKKYBasic
NLS Segment(s)
PositionSequence
15-39AKPLKKGARVTKPKKAKPTKADKLV
66-87KGRKGKTADAGGKKQTGGSKKF
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGTVKISTKAATAKPLKKGARVTKPKKAKPTKADKLVKKYTSGLVNQTEKLLGERAGHLELIGKGRKGKTADAGGKKQTGGSKKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.46
4 0.54
5 0.54
6 0.55
7 0.62
8 0.63
9 0.65
10 0.7
11 0.71
12 0.72
13 0.8
14 0.81
15 0.82
16 0.83
17 0.81
18 0.8
19 0.84
20 0.83
21 0.83
22 0.85
23 0.81
24 0.79
25 0.78
26 0.69
27 0.6
28 0.53
29 0.46
30 0.4
31 0.35
32 0.29
33 0.26
34 0.27
35 0.25
36 0.24
37 0.2
38 0.17
39 0.17
40 0.14
41 0.1
42 0.09
43 0.1
44 0.11
45 0.12
46 0.11
47 0.1
48 0.12
49 0.12
50 0.16
51 0.17
52 0.17
53 0.2
54 0.21
55 0.27
56 0.27
57 0.28
58 0.3
59 0.37
60 0.45
61 0.49
62 0.54
63 0.54
64 0.53
65 0.51
66 0.48
67 0.45
68 0.45