Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GXM0

Protein Details
Accession A0A2I1GXM0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MPKQKNQPTPFYKKNKDRHSKNRKIWRIKRAKEHQENLRRBasic
NLS Segment(s)
PositionSequence
13-32KKNKDRHSKNRKIWRIKRAK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPKQKNQPTPFYKKNKDRHSKNRKIWRIKRAKEHQENLRRQSEQATTIPSVVSPSDNNINNEPIEPPCQPVDDPPTDET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.88
4 0.88
5 0.9
6 0.91
7 0.91
8 0.91
9 0.92
10 0.91
11 0.92
12 0.9
13 0.9
14 0.89
15 0.85
16 0.86
17 0.85
18 0.86
19 0.84
20 0.82
21 0.81
22 0.8
23 0.79
24 0.74
25 0.69
26 0.58
27 0.49
28 0.46
29 0.38
30 0.31
31 0.26
32 0.24
33 0.19
34 0.19
35 0.18
36 0.15
37 0.14
38 0.11
39 0.11
40 0.08
41 0.1
42 0.17
43 0.2
44 0.23
45 0.24
46 0.25
47 0.24
48 0.25
49 0.24
50 0.19
51 0.21
52 0.19
53 0.2
54 0.19
55 0.21
56 0.2
57 0.24
58 0.29
59 0.3