Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GQQ6

Protein Details
Accession A0A2I1GQQ6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
113-139YDEQRNLRERARRKDTKKKRRPRYNGFBasic
NLS Segment(s)
PositionSequence
117-135RNLRERARRKDTKKKRRPR
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MFYYKHILNFQNSRKILQQVPQPVPQSTNTAKQVKNHLGRKSQGIQSTSNYVNLPTKTKSPFLRTKLRAERTSDINSGRVKKTEPFKFKAKPLTKVVEFNLHIDARIEKRKIYDEQRNLRERARRKDTKKKRRPRYNGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.48
4 0.45
5 0.46
6 0.45
7 0.49
8 0.52
9 0.51
10 0.47
11 0.45
12 0.41
13 0.4
14 0.34
15 0.37
16 0.38
17 0.42
18 0.43
19 0.45
20 0.52
21 0.54
22 0.6
23 0.59
24 0.59
25 0.58
26 0.58
27 0.6
28 0.57
29 0.52
30 0.48
31 0.43
32 0.39
33 0.35
34 0.38
35 0.32
36 0.28
37 0.23
38 0.2
39 0.21
40 0.2
41 0.22
42 0.18
43 0.22
44 0.22
45 0.27
46 0.29
47 0.33
48 0.39
49 0.42
50 0.51
51 0.5
52 0.57
53 0.61
54 0.64
55 0.6
56 0.57
57 0.54
58 0.49
59 0.49
60 0.42
61 0.34
62 0.32
63 0.32
64 0.3
65 0.29
66 0.25
67 0.23
68 0.25
69 0.33
70 0.38
71 0.42
72 0.42
73 0.49
74 0.53
75 0.57
76 0.62
77 0.59
78 0.56
79 0.55
80 0.58
81 0.53
82 0.51
83 0.48
84 0.46
85 0.41
86 0.36
87 0.35
88 0.28
89 0.25
90 0.23
91 0.24
92 0.21
93 0.28
94 0.28
95 0.24
96 0.27
97 0.33
98 0.39
99 0.44
100 0.5
101 0.52
102 0.61
103 0.69
104 0.73
105 0.7
106 0.7
107 0.7
108 0.68
109 0.69
110 0.69
111 0.71
112 0.74
113 0.83
114 0.88
115 0.9
116 0.92
117 0.92
118 0.93
119 0.94