Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GEB2

Protein Details
Accession A0A2I1GEB2   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28MEEKGKGKGKRKGKEWEKNREGKGQBasic
39-71EDESKRRKGKVKEGRNGKKKRKGEGQRKEEREKBasic
NLS Segment(s)
PositionSequence
7-92KGKGKGKRKGKEWEKNREGKGQREEEEGERKREDESKRRKGKVKEGRNGKKKRKGEGQRKEEREKGSERGMVKAKEEMGKDKKEKK
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
Amino Acid Sequences MLEMEEKGKGKGKRKGKEWEKNREGKGQREEEEGERKREDESKRRKGKVKEGRNGKKKRKGEGQRKEEREKGSERGMVKAKEEMGKDKKEKKIESHEGGDSLEIKKIFKECYDGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.75
3 0.79
4 0.83
5 0.83
6 0.86
7 0.85
8 0.85
9 0.81
10 0.79
11 0.73
12 0.71
13 0.7
14 0.66
15 0.58
16 0.53
17 0.52
18 0.47
19 0.52
20 0.47
21 0.42
22 0.37
23 0.35
24 0.33
25 0.37
26 0.4
27 0.4
28 0.47
29 0.54
30 0.62
31 0.68
32 0.74
33 0.73
34 0.77
35 0.77
36 0.76
37 0.74
38 0.76
39 0.8
40 0.83
41 0.87
42 0.85
43 0.84
44 0.79
45 0.77
46 0.76
47 0.77
48 0.78
49 0.78
50 0.78
51 0.79
52 0.81
53 0.79
54 0.74
55 0.67
56 0.6
57 0.53
58 0.46
59 0.41
60 0.38
61 0.34
62 0.34
63 0.36
64 0.33
65 0.3
66 0.3
67 0.28
68 0.28
69 0.29
70 0.32
71 0.33
72 0.4
73 0.46
74 0.52
75 0.57
76 0.61
77 0.64
78 0.63
79 0.67
80 0.69
81 0.67
82 0.63
83 0.58
84 0.51
85 0.47
86 0.4
87 0.32
88 0.23
89 0.21
90 0.17
91 0.16
92 0.18
93 0.21
94 0.22
95 0.21