Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HWG8

Protein Details
Accession A0A2I1HWG8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-105GIEPPPKRKNITPPNPKLKKMHydrophilic
NLS Segment(s)
PositionSequence
74-105RKKKIKEAQIQGIEPPPKRKNITPPNPKLKKM
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences IYILNNLQLQRNLRDRLNATCEKGKYASEQTPGKIRSVITSFKSDFPTFPVSVGDFVLQKITEDIVGNWAETERKKKIKEAQIQGIEPPPKRKNITPPNPKLKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.44
4 0.49
5 0.47
6 0.44
7 0.47
8 0.46
9 0.42
10 0.41
11 0.36
12 0.33
13 0.34
14 0.33
15 0.33
16 0.35
17 0.34
18 0.4
19 0.4
20 0.36
21 0.32
22 0.27
23 0.25
24 0.25
25 0.28
26 0.22
27 0.26
28 0.27
29 0.28
30 0.32
31 0.29
32 0.25
33 0.25
34 0.27
35 0.22
36 0.21
37 0.19
38 0.15
39 0.15
40 0.15
41 0.12
42 0.07
43 0.07
44 0.08
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.09
53 0.09
54 0.09
55 0.08
56 0.09
57 0.1
58 0.12
59 0.18
60 0.22
61 0.29
62 0.32
63 0.39
64 0.48
65 0.55
66 0.63
67 0.66
68 0.68
69 0.67
70 0.66
71 0.62
72 0.59
73 0.55
74 0.49
75 0.49
76 0.44
77 0.45
78 0.49
79 0.53
80 0.57
81 0.62
82 0.7
83 0.72
84 0.78
85 0.83